CAZyme Information: MGYG000000278_00503

Basic Information

• Species: UBA3402 sp003478355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3402; UBA3402 sp003478355
• CAZyme ID: MGYG000000278_00503
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000000278_2|CGC2	47580.67	6.9968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000278	4338723	Isolate	China	Asia

• Gene Location: Start: 184949; End: 186223 Strand: -

Full Sequence      

MSWKSILNYQHYVEKEKGWTKAFEKAVEDLEKEGGGTIYVPAGKYETCSIELKSNMTLYL
ETGSRLEYFGELEKYKTINFSYIGRPMCMYMPLIYARKADHVMVCGQGVIDGHGENWWGR
KAEFRKKGLRRPHMICFDHCRNVKVKDVTLINSPAWTIHPCSCDQVLIQGVSIKNPADSP
NTDGINPNSSRNVRIENCVIDVGDDCIAIKSGTEDSENPEPCENVIISNCNMIHGHGGIV
IGSEMSGGIRNVVVTNCVFQDTDRGIRIKSRRKRGGIVEQIRIQNIIMEKVICPFIVNLY
YFCGEKGKEKYVWDKNPYPVDQSTPMVREVRISHVSVYQASAAAGFFYGLKEMPIQDISI
EDSVIWMDPDGKPGKPAMMDGVDPVKGAGFILKNVSGIHLSKVVIHNCNGSMIDADETAR
FIID

Enzyme Prediction     

No EC number prediction in MGYG000000278_00503.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	31	371	1.1e-92	0.92

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.34e-88	20	421	99	510	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	3.48e-39	102	291	55	239	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02793	PLN02793	4.74e-36	94	342	137	369	Probable polygalacturonase
PLN03003	PLN03003	6.04e-33	102	310	115	310	Probable polygalacturonase At3g15720
PLN02218	PLN02218	4.26e-32	106	361	164	404	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ05898.1	2.29e-143	20	414	19	412
QFK71226.1	3.84e-143	20	410	25	414
ADQ05623.1	4.60e-143	20	414	19	412
ADQ41451.1	1.31e-142	20	414	19	412
AGC67947.1	2.11e-142	20	410	23	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	5.51e-52	20	365	44	410	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	8.21e-37	20	286	61	355	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
1BHE_A	1.88e-22	20	301	26	314	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
2UVE_A	5.73e-15	20	285	173	484	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4MXN_A	7.31e-13	20	199	38	236	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	1.35e-49	119	386	12	282	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	1.06e-46	20	322	79	388	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q9LW07	4.72e-28	100	310	113	310	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
Q7M1E7	2.76e-27	93	301	140	346	Polygalacturonase OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
Q9FY19	6.56e-27	95	301	143	347	Polygalacturonase OS=Juniperus ashei OX=13101 GN=JNA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000278_00503.