CAZyme Information: MGYG000000013_00026

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_00026
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000000013_1|CGC1	52604.91	7.7475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 44335; End: 45717 Strand: +

Full Sequence      

MKKLHYFILFIFCTVTCLAQQQNIPVPKPHQLKWHEAELGAVFHYDLHVFDGIRYEQGNN
RINPIEDYNIFNPTKLNTDQWVQAAKAAGCKFAVLTTSHETGFCLWQSDVNPYCLKAVKW
RDGKGDIVRDFVNSCRKYGVQPGIYVGVRWNALLGIHNFKAEGEGEFAVNRQTWYKRLCE
RMVTELCTRYGDLYMIWFDGGADDPRSDGPDVEPIVNKYQPNCLFYHNIDRADFRWGGSE
TGTVGYPCWSTFPAPCSHHKRLEQDKDLLELLKHGSKDGKYWVPAMADTPLRGANGRHEW
FWEPDDENNIYPVDVLMDKYEKSVGRNATLILGLTPDPTGLLPTGDVQRLKEMGDEINRR
FASPIAQTAGQKKSLPLKFGKKQPVNYCIIQENIKNGERIRQYKVEAKVNGKWKTVCTGE
SVGHKRIEKFEPVEATALRLTVLESTALPDIINFSAYSVQ

Enzyme Prediction     

No EC number prediction in MGYG000000013_00026.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	22	358	1.5e-61	0.8815028901734104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	3.13e-30	25	457	9	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.70e-26	71	355	79	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.86e-21	71	355	76	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKA50901.1	0.0	1	460	1	460
QUT69508.1	0.0	1	460	1	460
ALJ44007.1	0.0	1	460	1	460
BCA48353.1	0.0	1	460	1	460
SCV07935.1	0.0	1	460	1	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GZA_A	1.09e-316	19	460	2	443	Crystalstructure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482],3GZA_B Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482]
5K9H_A	1.37e-75	25	457	37	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3EYP_A	2.07e-66	26	457	9	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	2.19e-62	26	460	31	461	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	2.39e-52	27	459	19	478	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	7.32e-58	10	457	9	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	5.01e-56	24	458	37	477	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q99KR8	1.86e-08	66	354	95	351	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q6AYS4	1.01e-07	66	354	93	349	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
P49713	5.65e-07	71	358	92	343	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000235	0.999100	0.000226	0.000150	0.000137	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_00026.