CAZyme Information: MGYG000000032_00061

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_00061
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000000032_1|CGC3	54560.93	4.7841

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 72345; End: 73775 Strand: +

Full Sequence      

MGTLLVISEQEKKLVRVVPSERQMRHQKLEFYGFLHFTVNTFTDREWGDGTESPSVFCPE
HFDAEQWAETLAASGMRGAILTCKHHDGFCLWPSRYTAHTVAASPFRGGNGDVVREVSEA
LRKYNLKFGIYLSPWDRHEPCYGKGTQYDDFFVGQLTELLTGYGDIFCVWFDGACGEGPD
GNVQSYDWERYYEVIRRLQPEACISVCGPDIRWCGNEAGDTREQEWSVVPGRLRDTEKIR
ENSQQSDEKEFRQRTLSSSDQDLGSRAVLEGENDLVWYPTEVNFSIRPGWFYHESEDDQV
RSLENLISIYDRSVGGNSTMLLNVPPTKEGLIHDRDAERLRELGAYLRRREAHNLVEEAE
MTATGSEPGHDAANLRTDEEGSYKTPDGIRSCEIRLTWEEPVKVSMVVIKEDIRFSQRIE
KYRITSVCGEERQVLCEGKTVGWRKNAVFEPVTTNEIRVEILESRVAPVIRFLGVY

Enzyme Prediction     

No EC number prediction in MGYG000000032_00061.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	21	350	3.7e-78	0.8670520231213873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.02e-72	19	476	11	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	2.89e-44	22	349	48	330	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	3.25e-42	57	349	76	332	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR31700.1	1.23e-207	9	476	6	445
ASB42413.1	1.23e-207	9	476	6	445
ANU54367.1	1.23e-207	9	476	6	445
ANY66286.1	2.88e-196	12	476	8	475
QRV20823.1	3.80e-196	11	476	5	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UES_A	6.12e-166	14	470	14	470	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	8.07e-164	14	470	14	470	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	1.22e-163	14	470	16	472	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
4ZRX_A	6.87e-136	7	476	20	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	2.86e-98	18	476	38	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	2.20e-94	18	476	39	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	4.75e-90	18	476	37	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
P49713	1.93e-14	39	180	71	218	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
C3YWU0	7.10e-13	56	192	91	220	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
Q6AYS4	9.76e-13	56	188	98	235	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_00061.