CAZyme Information: MGYG000000203_00628

Basic Information

• Species: Butyricimonas virosa
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas virosa
• CAZyme ID: MGYG000000203_00628
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		49835.59	6.9596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000203	4537346	Isolate	China	Asia

• Gene Location: Start: 376828; End: 378123 Strand: +

Full Sequence      

MKNIFITTLLFLTVVFCSAQEKYVPSQENLTNREWFRDAKFGMFIHWGIYSMLADGEWVL
TNKSLNEAEYQKLADGFYPSKFNADEWVRIAKDAGMKYICFTSRHHDGFSMFDTKQSDYN
IVKATPFKRDVIKELAEACQKHGLKLFFYYSHIDWHRPDYYPWGRTGRNTGRTPSGTWED
YLKFMDAQLTELLTNYGPIGGIWFDGWWDKPDADWQLERQYTLIHRLQPGCLIGNNHHKA
PFEGEDFQMFERDLPGQNKAGYSADAEISALPLESCETMNNTWGYNINDRNFKSTKQLIH
TLVGAAGNNANLLLNVGPRPGGDFPEGSVRHLKEIGEWMRTYGETIQGTRAGIIPQQDWG
VTTQKGNKLYIHILNLNKTELLLPTTDRKIKSIVCFKDQTPVKYKKTKEGILLQLNEVPT
DIDHIVEIIWK

Enzyme Prediction     

EC	3.2.1.63

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	20	346	2.4e-111	0.9219653179190751

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	7.60e-149	19	344	2	333	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	6.52e-120	19	375	3	372	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	1.51e-44	46	351	1	324	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14871	GHL6	3.11e-08	83	205	1	134	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51237.1	0.0	1	431	1	431
AZS29753.1	2.39e-313	1	431	1	432
BCG54104.1	7.01e-223	1	426	1	428
QUT80506.1	1.21e-216	1	428	1	429
SCV10899.1	1.40e-215	1	428	1	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	3.45e-87	29	428	23	441	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
6O18_A	4.39e-57	32	325	4	325	ChainA, AlfC [Lacticaseibacillus casei],6O18_B Chain B, AlfC [Lacticaseibacillus casei],6O18_C Chain C, AlfC [Lacticaseibacillus casei],6O18_D Chain D, AlfC [Lacticaseibacillus casei],6O1A_A Chain A, AlfC [Lacticaseibacillus casei],6O1A_B Chain B, AlfC [Lacticaseibacillus casei],6O1A_C Chain C, AlfC [Lacticaseibacillus casei],6O1A_D Chain D, AlfC [Lacticaseibacillus casei]
2WVS_A	6.63e-57	21	390	3	396	Crystalstructure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_B Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_C Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_D Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482]
2WVT_A	6.63e-57	21	390	3	396	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVT_B Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVU_A Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_B Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_C Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_D Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482]
2XIB_A	8.32e-57	21	390	2	395	CrystalStructure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_C Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_D Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XII_A Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron],2XII_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9VTJ4	2.61e-36	9	349	10	370	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
P49713	1.02e-34	6	353	5	356	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
P10901	2.76e-34	1	415	1	440	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q99KR8	2.18e-31	23	349	28	364	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q9BTY2	2.91e-30	22	349	33	370	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000743	0.707078	0.291465	0.000248	0.000231	0.000224

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000203_00628.