CAZyme Information: MGYG000001948_00064

Basic Information

• Species: Muribaculum sp002492595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002492595
• CAZyme ID: MGYG000001948_00064
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	MGYG000001948_1|CGC3	63642.65	6.6308

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001948	2811075	MAG	Denmark	Europe

• Gene Location: Start: 84782; End: 86464 Strand: -

Full Sequence      

MYNFAVNRNQYLTNMNYCKCLLAALLIPAAALSQNYEVPVSEAQEPMMKGKYDATWESLS
QYEVPEWFRDAKFGIWAHWGPQCVEGSGDWMARSMYIEGSNEYKHHVANYGHPSEVGFKD
ILPLFKAEKWDPDYLVGLYKKIGAKYFFALGNHHDNFDLWDSQYQEWNSKAIGPKRDLLA
GWAEACRKHGLKFGVSLHADHAWSWYEPSRRYDRNGDKAGVPYDGRMTKEDGKGKWWEGL
DPQNLYAQNHPDSYGSWSDGMIHRQWAWGNGVAVPTVEYCTNFYNRTLDVINRYNPDLLY
FDVTGVPFYPISDAGLKIAAHFYNHNSATHPNDFSAVMFGKILNDTQKEALVWDVERGAP
NNIPEKPWQTCSCIGGWHYNTDIYKNNWYKSAASVVKLLVDVVSKNGNLLLSIPLRADGT
FDEKEEEIIKGIGDWMAVNSECIYSTRPWHIFGEGPIAESDIAINAQGFNEGSYTAATSK
EIRFTQTPKHLYAIALAWPDDNMVHIKALADGSEYHKGRIKSVELLGYGKVKFTRTADGL
TVNLPADAKRSVAPVLRIKK

Enzyme Prediction     

No EC number prediction in MGYG000001948_00064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	34	444	1.5e-103	0.9682080924855492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	7.06e-127	46	509	1	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	1.12e-112	50	441	4	333	Alpha-L-fucosidase.
COG3669	AfuC	4.58e-93	78	560	1	426	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam16757	Fucosidase_C	8.68e-09	482	559	9	90	Alpha-L-fucosidase C-terminal domain. The C-terminal domain of Structure 1hl8 is constructed of eight anti-parallel-strands packed into two-sheets of five and three strands, respectively, forming a two-layer-sandwich containing a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36457.1	0.0	15	560	1	546
QUT56786.1	0.0	21	560	8	548
QUT85589.1	0.0	21	560	8	548
AII64783.1	0.0	21	560	8	548
QJR61122.1	0.0	21	560	8	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LJJ_A	1.57e-83	58	559	49	509	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	8.46e-83	58	559	49	509	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
4NI3_A	4.44e-66	50	558	5	489	ChainA, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
1ODU_A	1.41e-48	48	509	4	401	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
2ZWY_A	1.59e-48	48	509	4	401	alpha-L-fucosidase[Thermotoga maritima],2ZWY_B alpha-L-fucosidase [Thermotoga maritima],2ZWZ_A alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZWZ_B alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZX5_A alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX5_B alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX6_A alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX6_B alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX7_A alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX7_B alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX8_A alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX8_B alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX9_A alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZX9_B alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZXA_A alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXA_B alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXB_A alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXB_B alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXD_A alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima],2ZXD_B alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48300	3.24e-35	51	545	36	444	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1
Q60HF8	2.20e-34	51	545	38	447	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
P04066	2.91e-34	21	545	15	445	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
Q9BTY2	7.51e-34	51	545	33	446	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
P17164	9.54e-34	52	508	33	408	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000555	0.998626	0.000271	0.000193	0.000164	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001948_00064.