CAZyme Information: MGYG000001975_00172

Basic Information

• Species: Prevotella sp900552515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900552515
• CAZyme ID: MGYG000001975_00172
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	MGYG000001975_3|CGC1	69897	8.238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001975	2921145	MAG	Denmark	Europe

• Gene Location: Start: 21018; End: 22865 Strand: -

Full Sequence      

MNRKQIRKSLAMLACAAMLSVNASAQKNVKAPEPVLPLPEQKQVDWQKMETYAFIHFGLN
TFNDREWGYGDSDPKTFNPTHLDCEQWVKTLIAAGMKGVIFTAKHHDGFCLWPFEGNDYN
VSKSPWRGGKGNVVRELADACKKYGLKFAVYLSPWDRSRAEYATPDYLPYFYAQLRDLLT
NYGEVFEVWFDGANGGDGYYGGAKDQRTIDRKNYYNYPRIFEILDEIQPNAVVFGDGGPG
CRWVGNEKGFAGETNWSFLRKGEVYPGYPRHTELTYGHADGNQWTAAECDVSIRPGWFYH
PEEDSRVKSPEQLVDLYYRSVGHNATFLLNFPVDRDGLIHPIDSANAIAYHNIIQRELSN
NLVAGMKARVSSERGGQFTAKALTDNSWDTYWATPDGVTTGDIEFRFKKAQRMNRIMLQE
YIPLGQRVKKFSVEYLDNKGQWQTVEQPEETTTIGYKRLLRFATVVSKGIRVRILDSRGP
LCINNIGVYDGGKDAQLTWSKAAESIKSLPFTVVKKTADEVIIDLGEAKDITTLQYLPDQ
SDHRKGLVHTYSISTCDANGNVQKTLKKDEFSNIQNNPILQTVTFPTVKTRYLKFKAERM
VKAGEKMNYEKLGIN

Enzyme Prediction     

No EC number prediction in MGYG000001975_00172.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	12	345	1.2e-77	0.9161849710982659

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	6.09e-68	30	489	2	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.07e-38	66	342	69	316	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.50e-31	54	342	31	318	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	1.39e-11	367	486	1	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00754	F5_F8_type_C	1.87e-04	521	597	37	112	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25194.1	0.0	15	614	10	628
AKA52890.1	1.43e-308	12	614	6	625
BAD50115.1	2.04e-308	12	614	6	625
CUA19658.1	2.04e-308	12	614	6	625
CBW23704.1	2.89e-308	12	614	6	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	9.28e-162	33	615	33	584	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	6.37e-125	22	614	17	582	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3EYP_A	6.62e-117	38	489	9	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	6.10e-100	39	478	19	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	7.31e-98	39	478	19	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.55e-112	32	489	31	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	2.07e-109	32	489	33	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P17164	2.33e-08	46	374	77	377	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
P49713	4.24e-08	75	192	90	211	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q99KR8	9.40e-08	46	339	72	339	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001013	0.829144	0.168144	0.001031	0.000360	0.000273

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001975_00172.