CAZyme Information: MGYG000003746_00244

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A
• CAZyme ID: MGYG000003746_00244
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		68082.02	4.7755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003746	1821350	MAG	Canada	North America

• Gene Location: Start: 522; End: 2354 Strand: -

Full Sequence      

MKRSTKLLSLLVLSLPILGLMTSCEGAKQSTYYTQRVDFPKGATLDTKVEMASQLIPSEK
QQSWQELELTAFIHFGVNTFTNQEWGDGTEDPAIFVPDHLDTDQWVKTLKDAGFRLVILT
CKHHDGFCLWQTETTDHSVKSSPWRNGEGDVLRDLSASCKKYDMKLGVYLSPWDRNAVSY
GTGKDYNDLYIAQLTELLSDYGDIDEVWFDGACGEGPNGKVQEYDWKRVFDTIHKLQPNA
VSAIMGEDIRWVGNESGLGRETEWSATVLSPDSYPESDSLYKALDINAMAGDLGSRDMLA
KAGSLYWYPSEVDVSIRPGWFWHPEEGPKSLKQLSDIYLQSVGRNSVLLLNIPPTRDGLL
DERDVKRVGELGQWIRQLNEQRAATEDLAHEIKVGGSIVAELNPDMQVGVILLQEDISRG
QRVEKFHVDGLMDDGTWSQIAQGTTIGYKRLLPLEVQARYSKIRLVIDEGRGGSVYIRHI
NALVLPPLIGTEPGAEMTGITPLSKQGWTVSSVSPLEILFGRELSVQGFIYSPAKGRDAT
TLPFTYLLEGTKDGKSWQPLAKGEFSNIVNNPIPQKIRLDQAYMLRGIRLTGTTVEGHGV
PLEDTEVTLY

Enzyme Prediction     

No EC number prediction in MGYG000003746_00244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	53	378	1e-79	0.884393063583815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.66e-69	57	469	11	417	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.75e-39	95	380	79	333	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	7.64e-31	64	376	23	331	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	5.45e-05	507	599	28	119	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT71427.1	2.70e-217	6	607	3	599
QUT80690.1	2.70e-217	6	607	3	599
QDM09076.1	2.70e-217	6	607	3	599
SCV10694.1	3.82e-217	6	607	3	599
ALJ46339.1	3.82e-217	6	607	3	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	3.33e-212	26	607	1	580	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	3.50e-130	57	471	19	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	1.67e-128	57	471	21	467	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	4.41e-128	57	471	19	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
5K9H_A	4.27e-104	56	609	38	585	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.48e-111	56	471	37	466	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.50e-100	56	471	39	465	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	1.94e-09	95	399	92	366	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q5RFI5	3.06e-08	64	376	76	359	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
Q9BTY2	3.08e-08	64	376	78	361	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000035	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003746_00244.