CAZyme Information: MGYG000003987_00435

Basic Information

• Species: UBA1691 sp900544375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1691; UBA1691 sp900544375
• CAZyme ID: MGYG000003987_00435
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	MGYG000003987_10|CGC1	58598.48	8.4879

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003987	2710592	MAG	United Kingdom	Europe

• Gene Location: Start: 437; End: 1966 Strand: +

Full Sequence      

MNRLDFYTSITPSTRQLEIQSLGFYAFLHFGMNTFLDKEWSDGKASPSLFCPTQLDTDQW
VRALRNAGMRGAILTAKHHDGFCLWPSKLTNYTVALSPYRNGKGDIVGELSRSCAKYGLK
FGIYLSPWDRHDERYGTPAYDEFYVGQLTELLTQYGEIFTVWLDGACGTYLDGKPKQAYD
FDRYYETIRRLQPGCIISNCGPDVRWIGNESGITRRSEWNVVPRFAYDIQTIENNSQQAD
DPAFRKKGADIAYSDLGSRRALEGHDELIWYPAEADVSIRPGWFFHQKENGRVRSIDNLL
HLYYSTVGGNTLLLLNIPPDQRGLIHEKDAARLAELGRRLRSAFSHQVLFERITAPEGKE
GFFIKNCLRPDESCYSPLVQAERYTVLLDFKRESLIDKIVLQEDTRYSQRVEAFTIEVLS
GSRWKQIYSGTVIGFSKIARFRPILTQKLKITITACRKEPYLRTIQVFESDGTEVKTPKT
LWLRKKAEELNYRLFIYAENHKATSKSTQ

Enzyme Prediction     

No EC number prediction in MGYG000003987_00435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	20	340	1.5e-78	0.8410404624277457

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	4.07e-69	12	468	11	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.69e-42	48	341	77	329	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	3.16e-30	49	341	75	331	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS20435.1	6.66e-166	7	476	2	441
ANY66286.1	6.99e-166	9	474	12	481
ANA78742.1	1.18e-164	2	472	3	473
AVV57345.1	1.18e-164	2	472	3	473
AWP26501.1	1.68e-164	2	472	3	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	2.33e-140	3	482	23	472	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	1.25e-137	4	462	11	470	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	1.62e-135	4	462	11	470	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	6.92e-135	4	462	13	472	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
5K9H_A	1.57e-97	12	468	39	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	7.24e-106	12	489	38	500	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	8.75e-104	12	468	40	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	1.01e-08	35	165	74	211	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
P10901	1.28e-08	56	165	106	223	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
P48300	6.55e-07	58	126	118	184	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000024	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003987_00435.