CAZyme Information: MGYG000004413_00092

Basic Information

• Species: CAG-488 sp003486665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-488; CAG-488 sp003486665
• CAZyme ID: MGYG000004413_00092
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	MGYG000004413_4|CGC1	51245.65	5.3577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004413	2138170	MAG	Israel	Asia

• Gene Location: Start: 6644; End: 7987 Strand: +

Full Sequence      

MKDFIKQAAHVKPSENQLRLLTETPFYAFVHFSPNTYTNLEWGTGKEDPSIFNPVNLDCD
GWCEAIKSAGMSGVVITAKHHDGFCLWQTEYTDHSMKRSPYKNGKGDIVGELSEACRRHS
LKFGFYLSPWDRHSELYGTEEYNDYYKAQLTELLTRYGEIFHVWFDGACGEGPNGKKQVY
DFDGFFDLIHKYQPRATIFSDKGPIRWCGNEDGLARYAEWAVVPSELCSYCEIQTMSGPL
CGDLSYMYNTDKNIGSLGNILYSKGLVFAPSEVDMSIRPGWFYHENEAPHSLERLFDTYL
RSVGGNAAFILNIPPKPDGTFDERDVSRLKELGEKIRTSFSINLAMDKPILIEPYKNSDT
QCTAEIDLGKDEDIHYLDFCEDIAQGQRIESFFVQQYKNDRWENVFEGTTVGARRIIRFK
DGLRTSKLRIFITSSRDKPEFGKIAIY

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	11	336	4.2e-77	0.8728323699421965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	4.26e-69	12	447	10	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	1.23e-43	52	334	76	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.10e-42	52	334	79	326	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV20379.1	2.62e-173	1	447	1	456
QGG57162.1	5.96e-144	3	447	4	470
QOT10938.1	7.90e-144	1	447	1	469
ACX66885.1	2.65e-142	1	447	1	469
QQR31700.1	2.79e-142	2	447	5	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	1.33e-118	5	447	24	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	1.36e-114	9	445	15	474	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	8.14e-114	9	445	17	476	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	1.72e-112	9	445	15	474	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
5K9H_A	1.45e-99	13	447	39	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.39e-109	29	447	53	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	2.85e-96	29	419	55	449	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q9BTY2	2.63e-11	51	339	106	363	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
C3YWU0	3.25e-10	25	167	81	214	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
Q5RFI5	3.38e-10	51	207	104	261	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004413_00092.