CAZyme Information: MGYG000000284_00082

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_00082
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	MGYG000000284_1|CGC4	79420.93	6.6705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 118804; End: 120966 Strand: -

Full Sequence      

MNYIKKTGWLVWGLIGYFTAFSQTKPIYQDATKPVEERIEDALSRMTQEEKVRLLHANGG
YRSWGVPRLGIPENNPTDGPTGMRPEFRWESWSDANANNDYCTAFPSLISLAATWNPDMG
ILYGKSYSEEALYRNKNIILGPGVNICRTPLNGRSFEYMGEDPYLSSQIAVSYIHGVQSN
HVAACVKHFAANNQETERYSVNSLVDERTLHEIYFPAFKAAVQQGHVWTVMGAYNRLNGQ
HCCHNDYLLNDILKKEWGFDGVLLSDFGGTHSTQEAILNGLDLEYGTALGSEEAFENYYL
GNAYLQLLKSGKADEKVLNEKVRRVLRMMYRTNMSPNRPWGVMNNREHTDAARRIAEEGI
VLLKNEASILPLSLSGLKKIVVVGENAIRTVTNGGGSSEVKALYEVTPLEGIKNMAGDKI
EVVYQPGYSSRLKGASADSLKREALKAVAGADVVVYVGGLNKEPNQDSEGSDRLSYNLPY
GQDELIAELSKANPHLVAVMISGNAYAIPWLKQVPGILQAWYGGTESGNAIASVLFGKTN
PSGKLPVTFPVRLDDVAAHALGAYPGDGKTVEYKEGIFVGYRWAEKEKIKPNFAFGHGLS
YTTFKYGNVTVDKKVVDATGRLTVTVPVTNTGAREGSEVVQLYVSDLKSSLPRPVKELKG
FCKVQLAPGETVHVSFTIDKEALSFYDPAQHGWVVEPGKFQVLVGSASDDVRAKTMFELQ

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	65	284	4e-63	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	8.40e-123	103	720	118	765	beta-glucosidase BglX.
PLN03080	PLN03080	1.06e-72	30	688	44	753	Probable beta-xylosidase; Provisional
COG1472	BglX	7.83e-71	67	421	56	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.60e-69	360	581	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam14310	Fn3-like	2.50e-34	638	708	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFD05220.1	1.78e-314	14	720	13	739
BCG54556.1	6.55e-311	22	719	30	731
ABQ06403.1	1.76e-309	14	720	13	738
QSW89439.1	2.03e-308	14	720	13	738
QUT89173.1	2.18e-308	21	720	17	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	7.59e-172	39	714	5	663	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.21e-132	35	719	1	663	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.87e-119	37	719	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.34e-118	39	720	6	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X42_A	4.35e-118	37	719	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	4.03e-249	26	718	33	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	4.15e-171	39	714	5	663	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	2.83e-127	46	711	12	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	2.83e-127	46	711	12	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P27034	7.58e-126	39	719	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.213240	0.547003	0.238406	0.000499	0.000344	0.000494

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_00082.