CAZyme Information: MGYG000001410_00289

Basic Information

• Species: Sutterella wadsworthensis_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella wadsworthensis_A
• CAZyme ID: MGYG000001410_00289
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000001410_1|CGC4	35205.05	5.05

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001410	2665472	Isolate	not provided	not provided

• Gene Location: Start: 303206; End: 304183 Strand: -

Full Sequence      

MIEVLKPGPVCVDVEGLSLTEHERGRLRHPMTGMVILFTRNYRDREQLRALCDEIHAVRP
GILISVDHEGGRVQRFRSEFTDVPAMSEIAAHEDAEARFEAAGLVLAAELRACGVDFTFA
PVLDVDYGRSAVIGSRSLGTTPELVTAHAAALIRGLRRGGMASCGKHFPGHGWAEADSHT
ALPEDERDAESLMRDMLPYGKLPELASVMTAHVAYHAFEGEVATFSRRLLQDELRERLGF
RGLVFSDDLSMKGAAGGSVTEQAEKALAAGCDMVLVCNRPDMADELLANLRWTRTPEFDA
RLAGLAPAAACGGAELEEARSLLAA

Enzyme Prediction     

EC	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	62	276	1.4e-49	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05337	PRK05337	8.88e-148	7	325	1	331	beta-hexosaminidase; Provisional
COG1472	BglX	1.11e-92	5	291	3	294	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.67e-68	12	303	12	311	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	7.47e-11	89	325	126	352	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS90045.1	7.49e-130	8	307	14	316
BBF23992.1	2.77e-127	8	308	14	314
QDA54410.1	4.39e-123	8	307	14	316
VEH02825.1	5.06e-104	5	307	29	340
ANU65497.1	5.27e-104	8	307	9	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G6C_A	3.22e-94	7	302	11	315	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315],4G6C_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315]
4GNV_A	3.43e-94	7	302	13	317	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4GNV_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4MSS_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],4MSS_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],5UTP_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTP_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTQ_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTQ_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTR_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],5UTR_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],6DTE_A GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia],6DTE_B GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia]
6JTI_A	2.50e-83	8	286	45	334	Crystalstructure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_B Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_C Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_D Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_E Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_F Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTJ_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTK_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTL_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae],6JTL_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae]
5G1M_A	3.70e-83	8	291	23	309	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
5G5U_A	1.18e-81	8	291	23	309	Crystalstructure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G5U_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_A Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_B Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5LY7_A Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5LY7_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1H075	2.46e-96	8	303	4	309	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1
Q2KXM7	1.45e-95	4	308	9	322	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
Q7NWB7	3.32e-93	5	306	3	314	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
Q7W9J5	2.68e-91	4	291	10	308	Beta-hexosaminidase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=nagZ PE=3 SV=2
Q7WH65	2.68e-91	4	291	10	308	Beta-hexosaminidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001410_00289.