CAZyme Information: MGYG000003411_00026

Basic Information

• Species: CAG-568 sp000434395
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-288; CAG-568; CAG-568 sp000434395
• CAZyme ID: MGYG000003411_00026
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1003		110573.98	4.3004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003411	1362982	MAG	Fiji	Oceania

• Gene Location: Start: 33558; End: 36569 Strand: +

Full Sequence      

MMIKKLWKKNSFKIWSITSGVLLATVIAVPIVLNTALADVLDFALGGADPIFKEGEQSAY
VKSFNSKDESKANADNVNVKLNEEGMVLLKNKNNALPLAKGSKISVFGKNSDNIAIGGSG
SGAASGDFIGVNESLRNAGFEVNPTLENFYHDNKLSGEGRSSASGDLDSGKPVTLKTGET
PQSSYTNEVKDSYKNYQDAAIIVLTRIGGEGMDLPMTMDGVEGARKSDDHYLQLDKNEED
LIVAVTNGGFKKVIVVINSGSAMELGFLEENAKYVTQKGYTIDPSKIDAAISIGYPGNSG
CKALGEIIAGDVNPSGKTVDTYATDFKKMPSWKNFSVNNDFDTEGGLGDQYMIGDQAKLY
YFADYEEGEYVGYRYYETRGFTDGNEWYNDNVVYPFGYGLSYTTFSWSVDATTVPSTLDP
TNEFTVEVEVKNEGSVAGKDVVEVYAKAPYKTGEIEKPYEILIGYAKTGLLEPGASEKVS
IDINPYYMASYDYKDANNNGFKGFELDAGTYSLSFNKNSHESIRSFDMELADNYQYAEDP
VTGTEVKNLYTDNVDASFNSDYQLKTILSRKDWEGTFPSPRTQEERTVSQDFIDKLDDKS
TNNPNDYDNDPQFDYPTVDDTKLYTIYDLLYKDNLDADGNYVVDEEGNKVRGEWVGEVSF
DDERWDRLLDQMNLAEVANMYNTAAYKIAGVDSVGLPVVTCADGPVGWTSFINPGLFEKT
ASYSCGVTVASTWNDELISEFGAAVGEEGLIGNGSTPYTGWYAPAMNIHRSPFGGRNFEY
FSEDPLLSGKVGAAEVRGCRSKGLVTFVKHFAANEQETHRSISGDCSWITEQALREIYLR
PFEITVKEGKTLGMMSSFNRIGTRWTGGDYRLLTTILRDEWGFNGAVICDFNTIPTYMDA
RQEAYAGGDLNLATMASSAWNYDESSIGDQLVLRRVLKDVCYSIVNANSMQGTVIGQTAP
KWFWINYAYIFGMLGVILVWGGIVITLDIKKIKAEEKAESDSK

Enzyme Prediction     

No EC number prediction in MGYG000003411_00026.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	690	912	1.9e-48	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.24e-28	677	890	41	248	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	8.42e-23	86	373	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	6.64e-22	84	493	393	739	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	6.68e-20	730	890	95	254	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	2.81e-17	84	521	401	774	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEU80232.1	1.16e-274	5	993	7	961
QOS39239.1	8.87e-267	6	991	3	965
VEU80230.1	1.08e-204	80	914	45	860
QQA37675.1	3.02e-175	73	962	88	892
QOL32307.1	1.02e-174	2	965	14	938

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	2.29e-71	84	891	46	748	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	1.74e-41	663	891	2	243	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	9.79e-41	663	888	2	240	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	3.80e-32	669	912	9	249	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.01e-29	666	896	7	232	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	3.81e-83	84	912	38	788	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	2.97e-65	81	946	16	782	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P27034	1.47e-35	666	891	3	223	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BFG8	2.50e-33	668	912	20	249	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
B8NDE2	5.66e-33	666	961	7	294	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.020284	0.978594	0.000387	0.000251	0.000225	0.000243

TMHMM  Annotations     

start	end
12	34
962	984