CAZyme Information: MGYG000000764_00034

Basic Information

• Species: Porphyromonas_A sp900541275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A sp900541275
• CAZyme ID: MGYG000000764_00034
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1269		140845.41	5.074

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000764	1992577	MAG	Bangladesh	Asia

• Gene Location: Start: 41952; End: 45761 Strand: -

Full Sequence      

MRRSSRLILASLALILSLTSLAQKVTRCEPTGPSVITITMDNGQARVLDFYSDHIVRIYQ
DPKGRLLQEPLSEPPAAIMVSHPRSATPFRISIGTDRSGNPVVSTDAVSITTGLKTGLMS
VTDLRSGKSVVRESRAPIFKDASSTLFLSMGESEYFYGGGVQNGRFSHRGQSIAIENTNN
WVDGGVASPTPFYWSTAGYGILAYTFRPGRYDFGEETKDQVALQHSQDYIDFFLMVSDTP
NKLISDYYTLTGRPALVPKFGYLEGHLNAYNRDYWLETTEPGKGILMEDGKHYVESQKDN
GGIKESLNGERDNYLFSARAVIDRYVRHDMPLGWVLPNDGYGAGYGQEDSLDGNIENLRQ
YGAYAHKHGVEIGLWTQSDLHPVEDIEPLLQRDLNKEVGTAGVRVLKTDVAWVGAGYSFG
LNGIADAAEIMIREGRGARPFIITLDGWAGTQRYGTVWSGDQTGGDWEYIRFHIPTYIGS
GLSGMPFISSDMDGIFGGGNLPVNVRDFQWKAFTPIQLNMDGWGANPKYPMALGEPATSI
NRSYLKLKSALLPYMYSCAYETLDGSPLMRPMFYEEASPYTLGSATKYQFLLGPSLLIAP
IYKETAPDKEGNDLRHGIYLPIGLWYDLFTGEPYEGGRVINCFDAPLWKLPVFVKAGAIL
PYTRPFNQISEIPKDFRGYALYGGADGSFSEYDDDGRTVAYTEGASVRTPLTLKMSGDRL
TFEIGCTKGGYKGFEPLKTTEIRLSVSQKPSAISVSVSGRPVLLREVTDREGYEKAKGGV
FLYDESPELNRYSTKGSESSQQSIKGNPVVLIKLDKVNTTSEPIRIAVEGYTINQPNHFY
RHTGRLQAPKMSPKESLVDAYTLTPHWSAVKGADFYEIELGSVLYSTILGEHFTLEELEP
ETDYTLRLRAVNSDGASDWSLLTLRTAKDPYENAIKEIVATTSVPNQSGQSVSKLFDRDK
STTWHTEWSKEATPFDLILDLRGVARLDSIEYFPRPDAGNGTLLKGTIAYSEDRKSWSDE
QPFDWSRDGSMKTFTFAEKPEARYLRLHITEGVGKYGSGQELYVYKVPGSTLRLQGDINR
DGRIDENDFTSYTNYVGLRTKDADFGYISIGDINKNGLIDAYDISTVGTVLDGGVYPSSK
VVSGRVTLSTDRTTFTEGEEIKILVTGSDLKQVNALSLALPYDATLVRYVGMRLIGMKDL
VNLSYDRLHSDGSKELLPTFVNRGNNFLLEDGELFEITFRALKSDSWTPEAVDGLLVDRN
LNTIDPLTK

Enzyme Prediction     

No EC number prediction in MGYG000000764_00034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	427	660	1.8e-58	0.522248243559719

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	4.41e-176	250	631	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	6.19e-72	83	746	69	752	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	2.97e-56	233	660	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	4.44e-41	430	698	204	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06589	GH31	1.41e-38	317	545	25	265	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24224.1	0.0	25	1264	41	1276
CDN30916.1	0.0	23	1264	25	1271
QFQ13576.1	0.0	22	1263	24	1264
QRY59398.1	0.0	24	1264	49	1286
QQT54226.1	0.0	24	1264	49	1286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	5.73e-269	38	932	52	963	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7R_A	3.22e-268	38	932	52	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	9.05e-268	38	932	52	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
6JR6_A	6.18e-40	154	753	156	784	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	8.18e-40	154	753	156	784	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	2.75e-42	147	732	140	746	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	3.79e-37	90	729	42	689	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
B9F676	1.50e-35	230	707	330	827	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
A7LXT0	7.85e-34	215	759	359	940	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9FN05	2.85e-30	230	707	332	829	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000540	0.996190	0.002647	0.000215	0.000207	0.000183

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000764_00034.