CAZyme Information: MGYG000001318_00120

Basic Information

• Species: Enterobacter cancerogenus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cancerogenus
• CAZyme ID: MGYG000001318_00120
• CAZy Family: GH31
• CAZyme Description: Sulfoquinovosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	MGYG000001318_6|CGC1	76920.54	4.9295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001318	4633453	Isolate	not provided	not provided

• Gene Location: Start: 22067; End: 24091 Strand: -

Full Sequence      

MRTLHDIDLKNTETGFTLRWQDRLIVSHSADAPCLWIGAGEADIEMFRGNFSIKDNLNEK
IALTEATVTQQDAGWAIRFTRGDAVSATLRIGVDAEGRLELKLQNDATSHNRIWLRLAAQ
PEDHIYGCGEQFSYFDLRGKPFPLWTSEQGVGRNKQTYVTWQADCKENAGGDYYWTFFPQ
PTFVSTQKYYCHVDNSCYMNFDFSAPGYHELAFWEDNATLRFECAETYVDLLEKLTALLG
RQPELPDWVYDGVTLGIQGGTDVCQQKLDAMRNGGVKVNGIWAQDWSGIRMTSFGKRVMW
NWKWNSELYPQLDTRIPQWKQEGVQFLSYINPYVASDRDLCEEAAQRGYLTKNAEGKDYH
VEFGEFYAGVIDLTNPEAYDWYKEVIKKNLIELGCGGWMADFGEYLPTDTFLHNGVSAEI
MHNAWPALWAKCNYEALEETGKLGEILFFMRAGYTGSQKHSVMMWAGDQNVDWSLDDGLA
SVVPAALSLAMTGHGLHHSDIGGYTTLFGMKRSKELLLRWCDFSAFTPMMRTHEGNRPGD
NWQFDADAETIAHFARMTRVFTTLKPYIKAAVAQNAKTGLPVMRPLFLHYEDDARAYTLK
YQYLFGRDLLVAPVHEEGRTDWTLYLPQDTWVNAWTGETCQGGDVTVEAPLGKPPVFYRQ
QSEWADLFSTLRHI

Enzyme Prediction     

No EC number prediction in MGYG000001318_00120.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	225	661	1.1e-101	0.9789227166276346

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	6	672	15	678	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10426	PRK10426	0.0	1	674	5	633	alpha-glucosidase; Provisional
cd06594	GH31_glucosidase_YihQ	0.0	240	558	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
pfam01055	Glyco_hydro_31	3.45e-81	226	659	6	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06589	GH31	5.41e-77	240	558	1	265	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGG10345.1	0.0	1	674	1	674
AUJ83659.1	0.0	1	674	1	674
QZY36866.1	0.0	1	674	1	674
CAD5360029.1	0.0	1	674	1	674
QWW79627.1	0.0	1	674	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AEE_A	0.0	4	674	8	678	Abacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5AED_A	0.0	4	674	8	678	Abacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
6PNR_A	6.81e-266	7	672	1	662	ChainA, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5OHY_A	2.21e-233	10	674	4	663	ChainA, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	1.26e-232	10	674	4	663	ChainA, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P32138	0.0	4	674	8	678	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
B3PEE6	3.43e-50	111	659	140	667	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1
Q9F234	5.73e-44	123	662	147	672	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
P31434	1.40e-42	103	642	140	646	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
P96793	1.44e-41	86	641	121	647	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001318_00120.