CAZyme Information: MGYG000001914_00014

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01
• CAZyme ID: MGYG000001914_00014
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000001914_1|CGC1	74598.31	4.8193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001914	1822971	MAG	Denmark	Europe

• Gene Location: Start: 18297; End: 20255 Strand: +

Full Sequence      

MLLNENLIEKTQTGYKIALKKKYRAVYGFGEKFDSCNQKGKYVRACVREKCFRQGEYTYL
SMPFFFTPDGFGMYVDTYVEVDFDFRTEGEVTIEFPRDSFGNRADVHWFEGTPKQIIEAF
RSVCGMPRLFPKWVLGAWMSSNRWHTQAEVEEQVALTKKFNFPHSVLVIEPWSDCTTHYL
WHGCTCTEKEGDEAIHYSDLDFSGSVWPDPKEMVEMLHEENLKLLLWIVPIYAQKSLESD
CNVQQILKVDEYVKEHGECVMNADGSPYEIPHTWCIGDLVPDFTNPVAKEHWFAHFQHLK
DIGIDGFKTDGGEFIHDHTVKFHDGTTGLEGQNAFCEQYIRAFADFIGEEGIVFSRAGGQ
RAPACSVIWSGDQESTWSEFASVIKAGISAGLSGVGCWGFDIAGFSGYLPSEELFRRAVE
TAAFVPVMQWHSEAVSNGRCDFTGAWPTNDRSPWNIAAFHKKGEEFLSLLRDQFRLHYNL
LPYQYMLLQESSRTGISPMRHLVLEFPEEEGVYEIDNEFMLGDALLIAPVLNDYISSQKV
YLPEDTWFHLFTGQKYTGGVWECSLERTPVFLRNNKCVPLNLSGGKLCSDVGSELDGYKE
LTFLVSGTGCYEFSDDLGNSILLEWDEKSDRVLRNERQIKVKILHIERTKLL

Enzyme Prediction     

No EC number prediction in MGYG000001914_00014.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	111	577	4.4e-100	0.9812646370023419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	8.71e-114	14	581	140	673	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06597	GH31_transferase_CtsY	1.29e-104	125	479	1	326	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	6.38e-99	109	573	3	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10658	PRK10658	5.50e-63	26	561	161	648	putative alpha-glucosidase; Provisional
cd06592	GH31_NET37	4.36e-62	131	547	3	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH28008.1	1.25e-175	8	627	22	622
QEY34934.1	9.06e-170	23	626	41	643
QKN24489.1	2.84e-165	23	626	41	642
ARP49780.1	8.03e-165	23	626	41	642
QKO30499.1	8.03e-165	23	626	41	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7U_A	4.28e-120	25	617	249	844	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
5I0D_A	5.37e-113	25	617	249	844	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]
4KMQ_A	7.81e-113	25	617	270	865	1.9Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e [Listeria monocytogenes EGD-e],4KWU_A 1.9 Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e in complex with alpha-D-glucose, beta-D-glucose, magnesium and calcium [Listeria monocytogenes EGD-e],5HPO_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with maltopentaose [Listeria monocytogenes EGD-e],5HXM_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with panose [Listeria monocytogenes]
5F7S_A	6.59e-90	26	559	175	711	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5I0G_B	9.53e-89	26	559	175	711	Cycloalternan-degradingenzyme from Trueperella pyogenes in complex with cycloalternan [Trueperella pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D2PPM7	1.75e-84	28	576	168	714	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1
Q5AW25	1.19e-54	26	608	180	720	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P31434	3.17e-48	26	580	162	671	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
P96793	9.12e-44	26	596	160	692	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	3.56e-43	27	580	150	676	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001914_00014.