CAZyme Information: MGYG000003202_00164

Basic Information

• Species: UBA3263 sp900759865
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA3263; UBA3263 sp900759865
• CAZyme ID: MGYG000003202_00164
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1234		136040.67	4.6051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003202	2219551	MAG	United States	North America

• Gene Location: Start: 512; End: 4216 Strand: +

Full Sequence      

MEVAFDGDAASLLVDFYGPNVFRVFQDPDGGILRDPKANPPAQILVDAPRVCPGKVEVRK
EGNATVVSTSRVKLTFPAEGKTFSVTDLSTGKTVVETVEPVAYTSKNTTVTLREHPGEYF
YGGGVQNGRFSHKGKVIDIVNTNSWTDGGVASPTPYYWSTDGYGIMWHTFAPGAYDFGAE
NPGKVSLTHDTPYLDLFVMVNDNPVGLLNDFYQLTGNPVLLPKFGFYEGHLNAYNRDYWK
EDENGILFEDGKRYKESQKDNGGIRESLNGELPGNYQFSARAVIDRYNAHDMPLGWVLPN
DGYGAGYGQTSSLDGNIANLREFGEYARKHGVEIGLWTQSDLHPKEGIEPLLQRDIVKEV
RDAGVRVLKTDVAWVGAGYSFGLNGVADVGEIMPYYGNDARPFIISLDGWAGTQRYAGIW
TGDQTGGQWEYIRFHIPTYIGSGLSGQPNICSDMDGIFGGKHPVMNTRDFQWKTWTPMQL
NMDGWGANPKYPQEFGGEYEKIVRAYLKLKSALLPYAYTYAREAVDGKPLIRAMFLDYPS
DYTHGVATKYQFLYGPDFLVAPIYQETRLQDDGSDVRNGIYLPEGTWYDYFSGRPYVSDG
TIVLNNFATPLWKLPVFVKAGAIIPMVNENNNPSQIDKSTRIYEIWPKEGKSEMTEYDDD
GTTEAYRNGRFSETHISADLNAKGVLTVAIDPTTGCFDGMTAQQATLLRIPATVEPKQVT
VTVNGKKIKAVKADNYDDLTVNSCGWFFYEAANRLAPYGTDGVEAETMPQLWVMVPSADR
TASGVKVEIKGYEFKPEAAVPAILAATAPAAPVVAMKEGDVNPYDLTLRWAPMTDATEIQ
VLHDGMLYTNLGVTEGENTAFFEDLKPETAYDFKLRAVNPAGASEWVDLALTTAANPLEF
AIPGITATATIPDQPGFGLWRAFDFEERGDIWHSIYSGADMPFDLTLDLGSFNTLDRLDY
LPRVDAGNGTILEGTWQVSENGKNWSDAQPFSWKRNADTKTIKFSGSTPMRYIRLHVDKT
VGRFASAREIFVFKVPGTPSYIPGDINKDGIIDANDLTSYTNYTGLRRGDSDFEYVSMGD
VNRNGLLDAFDISVVATKLDGGIEHPAAEIGGTLTLVPDKKIYAAGDEVVLTLAGKDLRN
VNALSLAIPYEQADYEFIGIEPDAASAMANLTYDRLHTSGDKVLYPTFVNLGDKATLNGD
QTIARIRFKARKRGAFAPQMTLPLLVSPALNVAE

Enzyme Prediction     

No EC number prediction in MGYG000003202_00164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	398	624	1.8e-57	0.5035128805620609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	0.0	214	593	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	1.38e-77	64	732	103	771	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	1.71e-53	398	624	227	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	2.90e-41	401	663	213	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06589	GH31	8.43e-35	279	507	25	265	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73263.1	0.0	12	1232	74	1291
QMW85577.1	0.0	12	1232	74	1291
AAO78275.1	0.0	12	1232	74	1291
QQA08685.1	0.0	12	1232	74	1291
ALJ44641.1	0.0	12	1232	74	1291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	7.72e-263	14	886	62	949	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7R_A	4.33e-262	14	886	62	949	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	1.22e-261	14	886	62	949	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7KMP_A	8.46e-25	398	709	635	946	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
5DKZ_A	1.65e-23	397	681	581	860	ChainA, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	7.20e-33	398	685	459	735	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9FN05	1.27e-28	295	687	470	841	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
Q9P999	4.10e-28	155	671	153	668	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
B9F676	4.05e-26	401	671	564	826	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
P38138	7.36e-26	395	681	586	868	Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ROT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003202_00164.