CAZyme Information: MGYG000003640_00923

Basic Information

• Species: Butyrivibrio_A sp900771195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A sp900771195
• CAZyme ID: MGYG000003640_00923
• CAZy Family: GH31
• CAZyme Description: Oligosaccharide 4-alpha-D-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654		74661.34	4.854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003640	1798350	MAG	Fiji	Oceania

• Gene Location: Start: 155888; End: 157852 Strand: +

Full Sequence      

MVTKFTYGTPLDTEAVVKPVAAATGSLPSFLNITEDNKTITSSMEPDDIIYGLGEQMGGI
NKRGRIYVSNNTDDPSHHESRTSLYASHNFFIVDGNIKYGIFIDFPATVSFDMGFTDKDL
IKIQIDEADYDLYVIEAQNTPDIISEFRELIGESYIAPKWAFGYQQSRWGYKSADDVRSV
VKNYRANNLPLDAVYLDIDYMERYKDFTVSSEAFPDFDSFVKEMQDEHIHIVPIIDAGVK
IEDGYDVYEEGVKHDYFCKDENGKDFVAAVWPGRVHLPDFLNKDARHWFGSKYKFLLDKG
IDGFWNDMNEPALFYSDKSLKNAFAELEKYDPENMDLYSLWDFQGLVGGLANNPADYRSF
YHNIDGKPVRHDKVHNLYGFNMTRAASEAFKKLVPDKNILMFSRSSYIGMHRYGGIWTGD
NCSWWAHIELLMHMLPGLNMCGFIYCGADTGGFGGDASEELMMRFTELSMFTPLMRNHSS
LGTREQELYRFKDTDSFRGLLKVRYGLIPYLYSEYIKAVKNNSLMFAPMGIAFPDDKKAR
HIEDQLMVGESIMIAPVYKPNCVGRYVYLPEDMTLIRFRSLTDRDIVTMAAGHHYFDCKA
NEVLVFIRKGHILPMGGDASCISEVSTGNFTIYGNHGASYELFTDENNSEIIQF

Enzyme Prediction     

EC	3.2.1.20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	133	613	1.1e-135	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06604	GH31_glucosidase_II_MalA	0.0	152	521	1	338	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
pfam01055	Glyco_hydro_31	3.28e-166	133	613	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	1.69e-130	1	645	111	705	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06603	GH31_GANC_GANAB_alpha	2.63e-109	152	615	1	428	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06602	GH31_MGAM_SI_GAA	8.11e-105	158	518	7	366	maltase-glucoamylase, sucrase-isomaltase, lysosomal acid alpha-glucosidase. This subgroup includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes Pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35590.1	2.56e-292	1	646	1	648
AOZ95318.1	8.18e-287	1	629	1	629
QRT48464.1	1.76e-278	1	646	1	646
ADZ82222.1	9.60e-278	1	646	2	651
QEH67919.1	1.11e-276	1	646	2	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C9X_A	1.03e-274	1	646	4	649	ChainA, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6C9X_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]
6CA1_A	1.03e-274	1	646	4	649	ChainA, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6CA1_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]
3NSX_A	1.69e-273	1	646	4	649	ChainA, alpha-glucosidase [Blautia obeum ATCC 29174],3NSX_B Chain B, alpha-glucosidase [Blautia obeum ATCC 29174]
3M6D_A	1.69e-273	1	646	4	649	ChainA, Uncharacterized protein [Blautia obeum ATCC 29174],3M6D_B Chain B, Uncharacterized protein [Blautia obeum ATCC 29174],3MKK_A Chain A, alpha-glucosidase GH31 family [Blautia obeum ATCC 29174],3MKK_B Chain B, alpha-glucosidase GH31 family [Blautia obeum ATCC 29174],3POC_A The crystal structure of the D307A mutant of alpha-Glucosidase (FAMILY 31) from Ruminococcus obeum ATCC 29174 in complex with acarbose [Blautia obeum ATCC 29174],3POC_B The crystal structure of the D307A mutant of alpha-Glucosidase (FAMILY 31) from Ruminococcus obeum ATCC 29174 in complex with acarbose [Blautia obeum ATCC 29174]
3M46_A	1.69e-273	1	646	4	649	ChainA, Uncharacterized protein [Blautia obeum ATCC 29174],3M46_B Chain B, Uncharacterized protein [Blautia obeum ATCC 29174]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	7.62e-117	44	646	143	710	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
P0CD66	1.26e-86	33	618	46	613	Alpha-glucosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=malA PE=1 SV=1
D0KQM8	1.47e-86	33	618	46	613	Alpha-glucosidase OS=Saccharolobus solfataricus (strain 98/2) OX=555311 GN=malA PE=1 SV=1
P70699	3.76e-81	42	624	249	836	Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2
O04893	6.68e-81	29	646	181	793	Alpha-glucosidase OS=Spinacia oleracea OX=3562 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003640_00923.