CAZyme Information: MGYG000003771_00124

Basic Information

• Species: Blautia sp002161285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp002161285
• CAZyme ID: MGYG000003771_00124
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		36963.99	4.6254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003771	3602220	MAG	Canada	North America

• Gene Location: Start: 76; End: 1047 Strand: +

Full Sequence      

MSLSGVANQGCDIGGFYGPAPEAELLVRWIQNGIFQPRFSIHSTNTDNTVTEPWMYSDCT
DYIREAIRFRYRLFPYLYSLMERAHETGLPIMEPMCSAFQNDPACYEEGVDFMLGDSLLV
ANVVEKGAKTRKVYFPKENRFFDFYTRMPYEGGETAELDVDLGSIPLFVRSGAIIPMALN
QMDNFATQRVTGLSILCEAGCDGAFTLYEDDGITMEYEKGAFLKTFITMKAGEQTTLSFR
NEGAYQTAVEDMQIDMIHREKSPYWVTVNGKEVPHFLHRKKFEGADFGWYYSQRLKSVQI
KYPNPKKDYEVVVSFEQFDLIGM

Enzyme Prediction     

No EC number prediction in MGYG000003771_00124.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	1	175	4.2e-63	0.4028103044496487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01055	Glyco_hydro_31	6.18e-75	1	175	270	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	3.43e-70	1	245	497	744	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06603	GH31_GANC_GANAB_alpha	8.78e-60	1	177	253	428	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06599	GH31_glycosidase_Aec37	2.18e-47	1	67	253	319	E.coli Aec37-like. Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37. The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06592	GH31_NET37	6.60e-31	13	137	241	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU22591.1	6.16e-185	1	323	511	833
QHB24649.1	1.98e-183	1	323	511	833
QEI32154.1	1.98e-183	1	323	511	833
QRT30796.1	2.81e-183	1	323	511	833
ASN98429.1	2.25e-182	1	323	511	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JR6_A	1.71e-43	11	314	521	837	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	1.71e-43	11	314	521	837	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
7KBJ_A	4.60e-33	1	218	289	508	ChainA, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7KBJ_C Chain C, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7KBR_A Chain A, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7KBR_C Chain C, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7L9E_A Chain A, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7L9E_C Chain C, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus]
5F0E_A	7.97e-33	1	218	549	768	Murineendoplasmic reticulum alpha-glucosidase II [Mus musculus],5H9O_A Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5H9O_C Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5HJO_A Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJO_C Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJR_A Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus],5HJR_C Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus]
5IEG_A	8.20e-33	1	218	604	823	Murineendoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9F676	2.76e-42	1	223	604	827	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
Q9FN05	5.90e-39	1	236	606	842	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
Q9P999	1.88e-38	1	272	446	724	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9BE70	2.93e-38	1	274	460	739	Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis OX=9541 GN=GANC PE=2 SV=2
Q9F234	7.76e-38	1	272	502	770	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003771_00124.