CAZyme Information: MGYG000003820_00203

Basic Information

• Species: UBA5446 sp900543085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA5446; UBA5446 sp900543085
• CAZyme ID: MGYG000003820_00203
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	MGYG000003820_2|CGC2	64868.92	4.6766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003820	2418429	MAG	United States	North America

• Gene Location: Start: 77174; End: 78910 Strand: -

Full Sequence      

MTMDYYTYKLPCEAFTVTSSNGVPAHFTCTGTSDGIEVRIAHGYAGAFGLGERYDALNYL
GKTAVNAVEEKFCRQGDKTYCPMPFFWTDSGLGVYAETARVTRFEFGRGSITLHLPEGCA
LHVFSGSPEEIVAAYMRVTGEPVLPPDWVFGSWISANHWDSREKLERAVAQAEEHGFPVS
VAVVEAWSDEATFYRFRSDTLWPEPEEMIERLHEKGIRLILWQIPVYKQLEPHEKPNAQL
ERDWDEAVRRGLCVKNADGTPYRIPEGHWFAGSLVPDFTNPETAESWFSRREYLTELGVD
GFKTDGGEFILSDGARFFDGTDGAEGRNLYPQMYTGAYTEHLKPGQALFSRAGYVGAHTT
PILWAGDQVSTFDELRSQLNAGLSASASGVIFWGFDIGGFAGELPSPELYLRATQLACFA
PIMQWHSEPDGGQFKLLQPGMEGNNERSPWNIERAFGMTGYTEQVRRWHLLRMELLPYIR
AEAAKCVESCRPLMRPMAYAFPGDARCVGIDDEYMFGDALLVAPVLSEGVSEREVYLPGG
EWRDFYTGERLPGGRAYTRNCADTIPVFVRSEYSVMEK

Enzyme Prediction     

No EC number prediction in MGYG000003820_00203.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	123	572	7.5e-116	0.9859484777517564

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06597	GH31_transferase_CtsY	1.81e-143	140	474	1	326	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	3.94e-136	48	571	156	666	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	2.76e-115	123	570	2	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10658	PRK10658	6.10e-78	48	570	162	663	putative alpha-glucosidase; Provisional
cd06593	GH31_xylosidase_YicI	2.05e-71	140	475	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU41630.1	5.53e-241	37	575	34	592
QQR05506.1	5.53e-241	37	575	34	592
QIA31700.1	2.23e-240	37	575	34	592
ADC90778.1	2.02e-219	44	575	39	592
QJT73077.1	1.12e-214	44	570	43	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7U_A	1.31e-118	48	571	251	798	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
5F7S_A	1.08e-113	49	570	177	728	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5I0G_B	1.65e-112	49	570	177	728	Cycloalternan-degradingenzyme from Trueperella pyogenes in complex with cycloalternan [Trueperella pyogenes]
5X3I_A	2.97e-112	49	571	188	732	ChainA, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3I_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3J_A Chain A, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3J_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3K_A Chain A, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3K_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836]
5I0D_A	6.20e-112	48	571	251	798	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D2PPM7	6.44e-113	49	571	168	712	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1
P31434	2.32e-62	48	570	163	664	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	8.47e-56	48	570	181	691	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	3.87e-50	48	570	161	669	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9P999	3.78e-47	83	571	152	618	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003820_00203.