CAZyme Information: MGYG000000193_00051

Basic Information

• Species: KLE1615 sp900066985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615; KLE1615 sp900066985
• CAZyme ID: MGYG000000193_00051
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
694	MGYG000000193_1|CGC2	80298.05	5.6698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000193	4116467	Isolate	China	Asia

• Gene Location: Start: 57284; End: 59368 Strand: +

Full Sequence      

MLSQLKMNPDPAYQNRLLPERDNASFFDGYSVWFYKEQGDLQQANAFTLEFEIAPFGISS
EGDAIFSCMDRKTSEGMAVRLTSDRKVEVILGFGGRQMVFYSIRENVDLEKWNHIFVIYR
FREGWCDLVVNGVLSNRLQFGRFQKIKWPRHPIFIGKDADKDCLTPQMGVFWGWMKNIQF
LSEAVSVEQAIKDSKRENSLEKVLYTPNRTRFLDDANRPQYHLIEPEKWMNEPHAPFFYN
GYYHIFYQANLHAPIWDSIQWGHLASKDMVHWKDLPLALQSENGFYDELGCWSGSGLVDK
DGVPRIYYTAGNNNRFPNQAVALAQPKDLEKDTLLKKWKKYPSLIKEQDIGCLGEFRDPF
VWIENESYFMLVGTGDEHNGGGNAALYVSADGLNWESCGMLVDYDYEINQKCGHVWELPV
LLPLRDDSGKIVCHIMMFCACQIEHDIVETYYFLGNWDASKKKFTKWNDRAMLLDLGHGT
FTGPSGFVTPDKRSVVFTIAQGKRPFSDEYHAGWAHNGGLPLQLWWDNGLKMQPIREILS
CEEKMLLERTNCGIEELNHDLEKINSNRMYVKLTTDADEIAICTESVVDESRYVQVVYNR
STKRFFARNAEGKEISRFRGSCDLVEVEGEITIEYFLDYSMIEVYLNQRKAMTLRNYVSG
GERKISVSSNSSKARINSIQIWNMKSAYDEKESR

Enzyme Prediction     

EC	2.4.1.-	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	222	527	2.6e-61	0.9692832764505119

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08996	GH32_FFase	1.55e-87	229	526	2	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	4.85e-69	224	648	2	436	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.76e-60	224	534	2	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
COG1621	SacC	1.08e-51	218	686	29	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
TIGR01322	scrB_fam	2.69e-48	211	647	7	432	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANC77361.1	7.29e-121	10	689	43	742
ADD03331.1	2.30e-116	3	688	66	772
QSS98785.1	3.79e-113	10	685	48	742
QYR23922.1	1.02e-112	22	690	49	745
BCG57729.1	2.65e-109	21	688	51	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.09e-35	219	685	27	486	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NUM_A	1.02e-29	219	686	41	514	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
1UYP_A	5.39e-29	218	682	3	431	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]
3UGF_A	7.57e-29	218	688	19	540	Crystalstructure of a 6-SST/6-SFT from Pachysandra terminalis [Pachysandra terminalis],3UGF_B Crystal structure of a 6-SST/6-SFT from Pachysandra terminalis [Pachysandra terminalis],3UGG_A Crystal structure of a 6-SST/6-SFT from Pachysandra terminalis in complex with 1-kestose [Pachysandra terminalis],3UGG_B Crystal structure of a 6-SST/6-SFT from Pachysandra terminalis in complex with 1-kestose [Pachysandra terminalis],3UGH_A Crystal structure of a 6-SST/6-SFT from Pachysandra terminalis in complex with 6-kestose [Pachysandra terminalis],3UGH_B Crystal structure of a 6-SST/6-SFT from Pachysandra terminalis in complex with 6-kestose [Pachysandra terminalis]
1W2T_A	9.77e-29	218	682	3	431	beta-fructosidasefrom Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_B beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_C beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_D beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_E beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_F beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
F8DVG5	2.13e-36	211	654	22	464	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) OX=555217 GN=sacA PE=3 SV=1
P0DJA7	7.17e-36	211	654	22	464	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) OX=264203 GN=sacA PE=1 SV=1
Q84PN8	3.68e-34	221	564	65	410	Fructan 1-exohydrolase w1 OS=Triticum aestivum OX=4565 GN=1-FEHw1 PE=1 SV=1
B6DZC8	2.14e-33	221	577	64	414	Fructan 1-exohydrolase w3 OS=Triticum aestivum OX=4565 GN=1-FEHw3 PE=1 SV=1
Q70AT7	3.96e-33	189	577	47	417	Fructan 1-exohydrolase OS=Hordeum vulgare OX=4513 GN=1-FEH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000193_00051.