CAZyme Information: MGYG000000838_00113

Basic Information

• Species: Agathobaculum sp900557315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Agathobaculum; Agathobaculum sp900557315
• CAZyme ID: MGYG000000838_00113
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	MGYG000000838_5|CGC1	52500.91	4.8268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000838	1767761	MAG	China	Asia

• Gene Location: Start: 9348; End: 10736 Strand: -

Full Sequence      

MSNALQRDLARLVARIEREDGPRAAADPYRQRFHLMPPVGWMNDPNGLCRCGEWYHVFYQ
YGPFDPTGGVKHWGHYRSRDLLHWEQLPSMLYPDQPWDIHGVYSGSALVEDGTMYLYYTG
NVKHAGDYDYITAGRGHNTALAVSCDGMTAETNELLLENRDYPADVTCHVRDPKVWAQDG
RYYMVLGARTKDDRGELLVYESADKRNWTHSNTLTTPEKFGYMWECPDLFELDGQWFLVC
SPQGVTRQGNKYQNVYSCGYFPLYGDFRGDYTLGEFRELDCGFDFYAPQSFQDAGRRLLI
GWMGMPDADYTNPTVENGWQHCMTVPCQLRREGERILRVPAPEIAALRGARIRPEQAQVF
DMECRTEAEGRLVIRGAAVVEWDKEQLSLTLAQGGEGRTVRYADVDTVASLRVLADASSL
EIFVNGGEQVLTTRYYPDPTACGVQMTGAQAEIWAMGVLQIQ

Enzyme Prediction     

No EC number prediction in MGYG000000838_00113.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	34	331	2.8e-95	0.9590443686006825

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	5.57e-161	40	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	3.67e-147	21	438	5	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	9.33e-137	27	450	26	472	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	3.30e-110	34	330	1	296	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.32e-109	34	427	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG05878.1	1.08e-202	3	458	2	465
CED94068.1	2.86e-165	3	448	2	463
QEH67471.1	9.88e-156	3	460	2	478
ADZ81804.1	5.23e-153	3	460	2	478
CBL24955.1	6.88e-149	3	450	2	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BWB_A	5.14e-75	6	438	30	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	7.80e-74	6	438	30	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
7VCO_A	7.25e-71	29	437	25	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	5.55e-56	23	436	26	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
6NUM_A	1.98e-54	32	436	42	485	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	2.87e-109	11	456	11	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P37075	9.09e-92	22	447	19	446	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P27217	5.39e-87	22	437	19	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
Q05936	1.02e-80	29	445	33	472	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P40714	3.90e-79	33	439	28	452	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000838_00113.