CAZyme Information: MGYG000000861_00064

Basic Information

• Species: Olsenella_B sp900548775
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900548775
• CAZyme ID: MGYG000000861_00064
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MGYG000000861_1|CGC3	51702.04	4.396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000861	2145101	MAG	China	Asia

• Gene Location: Start: 66826; End: 68223 Strand: +

Full Sequence      

MTPTNDRWTTNFHLAPRQGWLNDPNGLCQLHGTYHVFYQADPTWPAPGKKGWGHFASRDL
VRWEDLGEPLVPSIPEDADGVYSGSALVVPGGAPDGSDLLRLYYTGNVKYEGDHVHTGRD
ANQIMITSEDGISPSEKEVLLRPEDYPSDLTRHVRDPKVWVQDGHYYMVLGARRSDDVGD
VILYESSDAVAWTYRGRIESAHPFGYMWECPNVIQLDGRDYLVVCPQGLPSEQTRWQNLY
QAGYFPLPQGVLETERVDEASFVELDWGFDFYAPQVFEDEKGRCILIGWMGMPDAEYTSA
PEGLAWCHCLTVPREVTVGEDGLLCQWPVAEIDGLRGFAQPVSPTAGAILPHHHADIELV
GIEGDLEMGLDGLLELTFSAGEGMLRMTFINEAAALGRTERVMPLSALRELRVLVDGSTV
EVYVNHGKAVLSTRWFPTADTLLVTLHAACESARSWEMGGEPPRA

Enzyme Prediction     

No EC number prediction in MGYG000000861_00064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	13	328	2.6e-88	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	3.68e-156	19	318	1	287	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	8.75e-129	6	437	11	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.23e-112	1	449	21	471	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	7.47e-101	13	328	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.83e-93	13	427	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKT48814.1	4.10e-154	8	444	6	467
ADK67780.1	8.12e-152	8	456	22	477
QYX26047.1	9.88e-130	6	456	26	465
AVM70237.1	1.26e-129	8	442	5	418
QNM06260.1	1.70e-129	6	459	26	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	8.43e-70	7	448	24	470	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
3PIG_A	1.43e-62	5	454	36	503	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NUM_A	2.55e-60	5	433	36	482	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
6NU7_A	1.52e-57	11	458	35	485	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	1.10e-56	5	440	45	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.13e-90	11	452	31	469	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	3.35e-83	12	456	37	481	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P27217	2.42e-82	12	437	30	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P16553	5.34e-80	8	449	23	461	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P13394	7.84e-78	6	460	34	475	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000861_00064.