CAZyme Information: MGYG000000885_00061

Basic Information

• Species: Collinsella sp900541785
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900541785
• CAZyme ID: MGYG000000885_00061
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000000885_1|CGC1	54071.57	4.3895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000885	2151266	MAG	Denmark	Europe

• Gene Location: Start: 68516; End: 69958 Strand: -

Full Sequence      

MLNQKNKVTRADYEQWRVGQDETAARIASDPDRLLFHVEPELGWLNDPNGLVQIGDTYHI
YHQYDPFDAAHGGPVLWNHLTTKDFVTYENHGPVLFPDSDLDSSGAYSGSAFVRDGKIHY
FYTGNVKHFDRDDYDYVLTGREQNQIHMVAENPDELGEKCIAVGPVDYPDDIGTHVRDPK
ILEHDGIYYMVLGARTKDDRGCVLVYTSRNLEDWSYATRIELGEKFGFMWECPDLFELDG
ELILVCCPQGVPADGWRYRNPHQCVWFPIEADWEAPSFKIVGQGMPPMVDAGFDFYAPQS
FEDTAGRRLMIGWSGCPDATAENPTVARGWQCALTVPRELSMRDGKLCQQPAHEIERMRG
DCVLATGGETVEEPGRLFDLVVSCEGAKMVELEIRKGVFVCYADGMLTLDMDDEGYGRDQ
RSIELSELRDLRVLSDTTMVEIFANGGEAALTSRTYSPAVPAMELHAEGAASMNFYRLVH

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	351	1.2e-84	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.80e-141	43	344	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.36e-123	25	456	6	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.05e-120	28	475	24	479	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	1.46e-101	37	351	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.38e-96	37	447	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33880.1	0.0	25	480	2	457
AZH70195.1	0.0	1	478	1	478
QCP34478.1	4.63e-170	1	478	1	478
QMW71993.1	5.28e-164	1	457	1	458
BCD35034.1	5.28e-164	1	457	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	1.47e-59	25	457	25	463	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	6.39e-55	36	456	29	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.74e-49	1	478	21	482	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.40e-48	1	478	21	482	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	2.65e-44	36	468	43	498	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.70e-87	1	474	1	472	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P37075	2.47e-79	26	459	20	440	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P27217	3.72e-74	36	477	30	457	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
Q05936	1.15e-72	33	457	34	464	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	1.26e-72	36	456	40	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000105	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000885_00061.