CAZyme Information: MGYG000002190_00032

Basic Information

• Species: Clostridium sp001916075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp001916075
• CAZyme ID: MGYG000002190_00032
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000002190_1|CGC2	55238.36	4.9162

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002190	2598727	MAG	Spain	Europe

• Gene Location: Start: 34867; End: 36294 Strand: -

Full Sequence      

MITRAEYEQKIKEHIDNNMPKILSDKWRSKYHIMAPIGWINDPNGLCQFNDEYHVFYQYS
PLEAKGGMKFWGHFVSKDLVHFQERDIAIYPDVKEDKDGVYSGSAFVKDDTMYFFYTGNV
KHDGEHDYILTGREQNVMLVTSKDGIEFSEKKILLRNSDFPENMSLHVRDPKVWEEDGTY
YMVLGARGKDDKGYVLLYKSSDLYNWTLHSVPAGGEENMGYMWECPDLFYVDGKTVFMFS
PQGLKADGFKYNNVYQSGYAFGNFVNDKKELKLGNFVELDRGFDFYAPQTFEDAKGRRIM
IGWMGVPDAIEHKNPTVENYWQHQLTLPRELKIINNKLYQLPLKELETLRKDLIESKVDL
DNNNVLNIIDRNTFELRIDLEQCSKFSMKLREDCVVSFTEGVFKLIQGDSGYGRDERAAY
ISNLRSIDIFSDNSSMEIFINDGEEVFTTRVYNESLDSDIILSGKGTAVIKRWNI

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	32	342	3.8e-97	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	6.94e-168	38	335	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	4.10e-161	20	452	6	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.27e-157	6	471	7	478	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	9.31e-125	32	342	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	2.77e-117	32	443	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMC09096.1	3.57e-219	1	475	1	476
QJS19422.1	1.12e-215	1	475	1	476
ATD56793.1	3.55e-209	5	473	8	472
ATD55531.1	3.55e-209	5	473	8	472
SLK20339.1	3.55e-209	5	473	8	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	3.41e-85	31	469	29	475	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.26e-76	8	454	30	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.91e-75	8	454	30	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	2.29e-68	24	471	36	505	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
6NU7_A	2.34e-61	27	475	32	485	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.85e-122	6	466	7	467	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P40714	2.62e-91	31	471	28	469	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
Q05936	8.39e-91	7	454	13	465	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P37075	5.13e-88	11	452	10	438	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P27217	7.97e-87	11	473	10	458	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002190_00032.