CAZyme Information: MGYG000002279_00061

Basic Information

• Species: Dorea_A longicatena_B
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Dorea_A; Dorea_A longicatena_B
• CAZyme ID: MGYG000002279_00061
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000002279_1|CGC2	55496.19	4.5626

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002279	3143549	Isolate	China	Asia

• Gene Location: Start: 80415; End: 81845 Strand: +

Full Sequence      

MNALTRDLAKLVETAEQSQKTREELSVSDRKFREKLHLMPPVGWLNDPNGLCQFQGIYHA
FFQYSPFDAEGGVKMWGHYTSTNMIDWEYQGTALYPDQPFDCHGVYSGSAFIEDGKMYLY
YTGNVKLEDGEYDYIRTGREGNTVLVMTEDGKTFGRKKELMRNSDYPDDLTCHVRDPKVW
KENDIYYMVQGARTNEDVGQVLVFESEDKINWKFRNRIESENPFGYMWECPDYFEIGTKK
LLSASVQGLEGGIWDDCNVYQSGYFEIEGDILGEYKLSEYHLWDYGFDYYAPQSFETEDG
RRIHISWMGMPDCEEYTNPTIQTGWQHCFTFPREIFEKNGKICQRPIRELDEKKHLVSAV
KGMLSSDGYPVYELEILNIAENHFKVILSNELILDYADGRFRMHFISQDKTSVSAGRSMR
YVEVDEVKDLKILADRSSVEVFVNDGEYVFSTRYYPENHKLLAEAVEAQIRLSEIM

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	346	3e-88	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	2.71e-153	43	339	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	3.22e-131	10	456	3	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.29e-129	6	458	4	461	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	2.59e-109	37	346	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	4.23e-106	37	446	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34775.1	0.0	1	476	1	476
CBL24955.1	1.53e-283	1	475	1	473
QRT48577.1	2.55e-275	1	475	1	473
QRT30958.1	9.24e-258	1	475	1	468
QHB24857.1	2.64e-257	1	475	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	4.96e-67	31	460	24	463	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	5.57e-64	16	457	24	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	8.19e-63	16	457	24	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	1.38e-58	32	455	32	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
3PIG_A	3.14e-56	29	465	36	499	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	6.94e-99	22	465	19	465	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
A1STJ9	3.19e-83	31	459	94	518	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1
P16553	3.12e-82	37	457	28	450	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P37075	5.14e-81	37	456	31	439	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P27217	3.99e-80	37	456	31	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002279_00061.