CAZyme Information: MGYG000002593_00558

Basic Information

• Species: Limosilactobacillus sp900557215
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus sp900557215
• CAZyme ID: MGYG000002593_00558
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	MGYG000002593_5|CGC3	55893.13	5.5617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002593	1475799	MAG	China	Asia

• Gene Location: Start: 39958; End: 41433 Strand: -

Full Sequence      

MEWTREQRYLPYQQHSALELLKLQAQADNSPEQLRYHIRPASGLLNDPNGFSYFNHAWHV
FYQSFPFGAAHGLKSWMHMQSTDLVHWHSRGLALTPDNEYDSHGAYSGSAKQVGDRLFLM
YTGNHRDADWVRTPFQLGAWMDKNNHITKLEEPLFRNPNYISEHFRDPQLLEHDGKYYAL
LGAQDEKTEEGHLTLWTSDDLKNGWHDLGYVDFTPHDMGYMIECPNLVNVDGHPVLIFCP
QGLSKDVTNYENIYPNTYVTGDKFDFENAKLHGSSQIPVNLDDGFDVYATQAFNAPDGTA
YAISWVGLPDIEYPTDSQNWANCLSQVKELHLKDGKLYQQPVAAMTNLRSNKGINVFSNE
TKTINEHAGQQCELNLIIAADQSGTLHLAANYDLSKSLQIKFDTNRGILTVDRSTVGESV
AEKYGTTRTVTLPTHEDLKLQVFLDHSLAEIFVNDGRHVLTLRYFADQSQQTIAFDHNIN
STGTLYQLKNI

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	341	7.5e-78	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	0.0	22	467	3	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	8.37e-142	5	476	1	469	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18623	GH32_ScrB-like	3.74e-139	43	334	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam00251	Glyco_hydro_32N	2.42e-115	37	341	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	4.29e-113	37	456	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI95046.1	1.06e-260	1	491	1	487
QOL70071.1	1.74e-259	1	491	1	487
AJT49837.1	3.51e-259	1	491	1	487
QGF40919.1	1.04e-247	1	491	1	491
QYA52097.1	2.65e-225	1	491	1	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	8.13e-210	1	491	1	488	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	2.98e-56	36	473	29	466	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	8.21e-51	36	467	52	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.14e-49	36	467	52	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	2.03e-37	35	485	42	502	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43471	2.83e-158	1	465	1	461	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2
P13522	9.55e-146	8	489	8	478	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3
Q04937	1.96e-138	1	489	1	472	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1
Q05936	7.24e-107	2	469	3	467	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	2.25e-89	3	467	7	455	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999947	0.000052	0.000002	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002593_00558.