CAZyme Information: MGYG000002781_00247

Basic Information

• Species: UMGS775 sp900545325
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UMGS775; UMGS775 sp900545325
• CAZyme ID: MGYG000002781_00247
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MGYG000002781_7|CGC2	91262.53	4.385

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002781	1970017	MAG	United States	North America

• Gene Location: Start: 27919; End: 30387 Strand: +

Full Sequence      

MKRGFFKKAGTCLLACALAFGAAGTAGCAEKGAVSDGLAAYYSFDEGEGSYAKEKVSGKT
HEIYNVYAASNQQNLMKPSGEPLWREGVKGSCLYMDGVSNYIEDDSFKNLSTGALTLSAW
VAPRVFENNFKTEGLTCIAGKGDVGLQEGWLLGYGYLGTWGLKVALQDPETGNTFTAAFY
DPVNYLPLYEWSHVAASYDASSGRVCLYLNGELVYEQIYNEYAGCEIVPSSDPLRIGKYI
DPASVYGIDCNLVAGLLDEVYIYETELSHAQVKALYEDKDAAGHPACDYADVMLDSSVYE
GDRYRPQYHAIPPGMWMNEPHAAFYYNGYYHLFYQSNPNGPYWAQIRWSHWVSEDMVHWK
YVKEAVVPTKDICPDGVWTGGAVIGPDGTPWLVITAGTTTTTYSGQNIAFAHCADPTDPY
LEEWVVEDKVAITQEAGMGKINQFRDPFIWQDEGVYYMMVGSGKEGASSGGALFFTSSDM
RDWEYHGYVFESAAEEAGIHWECIQLLPVSTKDGSQQKYVFFLTPQYADDSRTVECYYWI
GTFDKEAKKFVPDAGYESPRLLDYGYGIFTGQTGFTYLTEEDAAAGKTYTQGRTVLFAIA
QGKEAGTTHNYYSGWAHNASLPVELFLSEDGHSLNVEPIPELTALRQETLYENGASMSAE
QANAAIGQVRGDLLEIRAKITVSETASNYKAGLYVRYNPYNNSLNQTERTALVFAENGVY
VDRSQTSLYVQGLKNSHVWENTEKEHDVIVYLDRSMLEIYIDGKVSFTSRMYPKYEDSDY
LSFFAEGCVLSVSDLTIYRLGSAYSDTVTPAYYGNTGSIKDA

Enzyme Prediction     

No EC number prediction in MGYG000002781_00247.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	309	634	5.2e-66	0.9829351535836177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00640	Glyco_32	2.21e-84	309	763	1	436	Glycosyl hydrolases family 32.
cd08996	GH32_FFase	6.10e-84	316	627	2	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam00251	Glyco_hydro_32N	3.18e-60	309	638	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
COG1621	SacC	4.10e-54	294	802	19	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18624	GH32_Fruct1-like	5.16e-50	316	569	2	250	glycoside hydrolase family 32 protein such as Arabidopsis thaliana cell-wall invertase 1 (AtBFruct1;Fruct1;AtcwINV1;At3g13790). This subfamily of glycosyl hydrolase family GH32 includes fructan beta-(2,1)-fructosidase and fructan 1-exohydrolase IIa (1-FEH IIa, EC 3.2.1.153), cell-wall invertase 1 (EC 3.2.1.26), sucrose:fructan 6-fructosyltransferase (6-Sst/6-Dft, EC 2.4.1.10), and levan fructosyltransferases (EC 2.4.1.-) among others. This enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD03331.1	8.38e-160	38	804	34	772
ADB62922.1	6.13e-146	38	804	12	753
AIQ31423.1	5.39e-141	37	804	9	758
BAA24360.1	3.64e-140	24	812	544	1318
ANC77361.1	7.39e-140	38	804	4	741

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UYP_A	6.23e-35	304	774	2	407	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]
1W2T_A	1.53e-34	304	774	2	407	beta-fructosidasefrom Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_B beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_C beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_D beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_E beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_F beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8]
2XQR_A	5.26e-33	304	774	4	502	Crystalstructure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_C Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_E Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_G Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_I Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_K Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana]
2AC1_A	5.49e-33	304	774	8	506	Crystalstructure of a cell-wall invertase from Arabidopsis thaliana [Arabidopsis thaliana]
2QQU_A	1.24e-32	304	774	4	502	ChainA, Beta-fructofuranosidase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2X5P7	1.45e-37	305	650	49	381	Beta-fructofuranosidase, insoluble isoenzyme 1 OS=Oryza sativa subsp. indica OX=39946 GN=CIN1 PE=2 SV=2
Q0E0P0	1.45e-37	305	650	49	381	Beta-fructofuranosidase, insoluble isoenzyme 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CIN1 PE=2 SV=1
Q01IS7	3.32e-37	275	646	29	392	Beta-fructofuranosidase, insoluble isoenzyme 2 OS=Oryza sativa subsp. indica OX=39946 GN=CIN2 PE=2 SV=2
Q0JDC5	3.32e-37	275	646	29	392	Beta-fructofuranosidase, insoluble isoenzyme 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CIN2 PE=1 SV=1
Q0JDC6	5.25e-37	289	646	31	385	Beta-fructofuranosidase, insoluble isoenzyme 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CIN3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000004	0.002288	0.997761	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002781_00247.