CAZyme Information: MGYG000002838_00122

Basic Information

• Species: Mediterraneibacter sp900541505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp900541505
• CAZyme ID: MGYG000002838_00122
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000002838_1|CGC1	55482.11	4.7027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002838	3567810	MAG	United States	North America

• Gene Location: Start: 122267; End: 123709 Strand: -

Full Sequence      

MNTLTRDLMNLTAEKEREAEEKRKAGCGRFRQTFHLMPPTGWLNDPNGLCQFKGVYHVFF
QYSPFDAQGGLKMWGHYTSRDMISWEYQGAALYPDQPFDCHGVYSGCAWIENEKMYLYYT
GNVKMEDRDDYINSGRQSNTVLVESEDGFHLGRKKLLMKNEDYPDDLTLHVRDPKVWKEN
GIYYMLQGARTKADTGQALIFESKDLYNWKFKSRIEAKGPSGYMWECPDYYEVGGVKLFG
ASLQGLEGEEWKDRNVYQSGYFTVDGDILTEYSLGSYCLWDYGFDYYAPQSFVSEDGRRI
QIGWMGMPDCEEYTNRTLEEGWQHCLTIPREIYTEGGVIRQRPVQELEEQEKKIISGVGE
LALEDHPVYDAVINGIEDNQFRAVLGEELILEYRDGRFEMRFTNQSKNSVSGGRRLRYTK
METVENVRILTDVSSVEVFVNDGAAVFTTRYYPENANIHVQAKGAQIEFREICVTSSPSC

Enzyme Prediction     

No EC number prediction in MGYG000002838_00122.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	35	342	4.7e-88	0.9931740614334471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.72e-152	41	332	1	285	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	3.03e-131	31	453	14	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.01e-124	30	457	28	463	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	2.37e-109	35	343	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	7.88e-105	35	443	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24955.1	2.81e-238	1	472	1	473
CCG34775.1	1.23e-237	1	472	1	475
QRT48577.1	2.78e-231	1	472	1	473
QHB24857.1	2.12e-229	1	472	1	468
QEI32364.1	2.12e-229	1	472	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.77e-69	8	453	3	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	5.86e-65	10	454	26	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	8.64e-64	10	454	26	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	1.79e-55	30	468	2	421	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]
1W2T_A	4.87e-55	30	468	2	421	beta-fructosidasefrom Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_B beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_C beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_D beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_E beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_F beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.52e-95	18	462	15	463	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P16553	8.98e-79	34	454	27	450	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
Q05936	2.03e-78	30	456	33	468	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	6.61e-77	33	466	39	466	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P40714	3.53e-74	30	454	24	451	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002838_00122.