CAZyme Information: MGYG000004696_00021

Basic Information

• Species: Collinsella sp900554665
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900554665
• CAZyme ID: MGYG000004696_00021
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510	MGYG000004696_1|CGC1	55467.83	4.4352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004696	2228648	MAG	United States	North America

• Gene Location: Start: 29570; End: 31102 Strand: +

Full Sequence      

MSNALGRDLAKLVAAVDAAASECGHGAYGQHFHIMPPAGWLNDPNGLCQAGGVFHAYFQY
APFDVEGGVKVWGHATSRDLMTWDYVGAPLLPDESFDCHGVYSGSALAEDGRIRVLYTGN
VKLSDADGTYDYVNTGRRADTVYVESTDGQAFGAKRVVLTSEDYPEDLTCHVRDPKVWRD
VDGRYHMVLGARRRVDGPHVESRFCAMHGEGAGRDVGEILVYGSADMLSWELENRVSTPE
RFGFMWECPSYIELDAKGGAPAKWLSFSPQGLESGRWDRGNVYAAGYMPVTGDITAGKDA
YDLGEFRLWDAGFDFYAPQEFTAEDGRHILIGWMGMPDEPTYGNDPTVACGWQHCMTVPR
ELTVGAGGVVLQQPAREIEHHYASVRVGEGSLEVAGDTCFDVIVAGVDGAFSATVDGELM
LAFVPAEGELPARFEMRFTDEARTAAGCGRAVRWEPVDEVRNVRIVGDASSVEVFVNDGA
LVFSTRIYPEAYGVTVDAVGASVTYHALNI

Enzyme Prediction     

No EC number prediction in MGYG000004696_00021.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	33	374	2.5e-79	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	3.16e-135	39	364	1	287	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	4.75e-112	28	489	13	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	9.02e-105	28	505	28	477	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	1.30e-95	33	374	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.03e-87	33	479	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33159.1	0.0	1	510	1	513
SDR64968.1	1.25e-196	1	510	1	483
AEB06470.1	1.61e-193	1	509	1	528
ADK67558.1	3.54e-181	1	504	1	476
AKT49546.1	3.37e-167	1	510	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.77e-52	28	489	25	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NUM_A	8.19e-52	8	488	20	485	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
3PIG_A	1.30e-50	8	488	20	485	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
7BWB_A	2.30e-48	28	490	48	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	3.13e-47	28	490	48	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	4.93e-81	30	502	30	469	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P27217	1.91e-71	32	489	30	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P16553	2.80e-69	32	491	27	451	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P40714	2.43e-66	31	490	27	451	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P37075	6.76e-60	32	493	30	443	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004696_00021.