CAZyme Information: MGYG000000246_00126

Basic Information

• Species: Streptococcus pasteurianus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus pasteurianus
• CAZyme ID: MGYG000000246_00126
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000000246_1|CGC4	43477.73	4.6556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000246	2159802	Isolate	China	Asia

• Gene Location: Start: 127476; End: 128648 Strand: +

Full Sequence      

MVVELPKVRVSNPDGIVYRDEFLGVDFALIPTGGKATAHAPALIETVDGGLLCAWFAGSF
EGSGDISIVVSKLNPDTQIWSEAEIVSKGVERSEQNPAFFRHPDGAIWLIYTSQLSRQEG
KDNMQFTSIIMVQKSTDEGNNWSEPEVLFPEEGTFSRQAIQILSNGRWIFATWICEDSPE
GLTNDPTEFRVSDDAGQNWRVVRMPESAGRVHANIIEVEPGHLVAFMRSRFADNIYISKS
HDFGDTWTVPEKTVLPNNNASISAIRLHSGEIALAYNNNSVSNPEFGKVAWPGLRNPVAV
SVTEDFGETWPIGRIFEQAEGFIGVENKTNNLQYEYPTLYQSKDGLLHLVYAYKNRLCVK
YVRFSIKDLFGEKRETEGLYNPTSGAGVEK

Enzyme Prediction     

No EC number prediction in MGYG000000246_00126.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	33	358	3.8e-37	0.9239766081871345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	6.27e-63	49	349	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	3.25e-59	32	365	8	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	1.88e-37	23	364	19	371	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
COG4409	NanH	2.92e-07	135	369	495	726	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI09029.1	8.60e-295	1	390	1	390
AWN18553.1	4.56e-251	2	390	1	389
AWN21141.1	9.20e-251	2	390	1	389
SQG13932.1	9.20e-251	2	390	1	389
VEI59842.1	4.53e-249	1	389	1	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MYV_A	1.33e-06	12	310	158	472	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MNJ_A	1.35e-06	41	335	203	521	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
6MRV_A	1.36e-06	12	310	179	493	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	1.36e-06	116	310	302	494	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000032	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000246_00126.