CAZyme Information: MGYG000003059_00167

Basic Information

• Species: CAG-180 sp900545625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-180; CAG-180 sp900545625
• CAZyme ID: MGYG000003059_00167
• CAZy Family: GH33
• CAZyme Description: Sialidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MGYG000003059_2|CGC1	56430.72	4.0624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003059	1925341	MAG	United States	North America

• Gene Location: Start: 21077; End: 22633 Strand: -

Full Sequence      

MRKVIKLLFSCLGAAAVFVLVLGFFITPKAGGAPNIAVDGVKPFSSASVINCNYYRIPAL
LTTTDGTVLAAIDARFGGTHDSPNNIDTAVSISTDSGKSWSEPQLVFQFDDFENTDDFLK
ENGTYTTQNSASVIDPALLQDTQTGRIFMLVDAFPHGAGAFAAQVGSGYTEINGEQALLL
RKQGEEDFAYTLRADGAIYDANGTKTAYTVNENGELSENGVPLTVQQKTQKYWYNLPFNL
NTRKEIPMHIFYRDSQFQPLSTSYLYLLYSDDNGETWSAPIDLNAQVKPDDVGFFGVCPG
RGLQIQNGTYAGRLLFCAYTLDPESGEQRFMTIFSDDGGSTWQAGEFVALTDEIRSMSET
QLIELPDGSLQAYSRTTNGFVSVAFSTDGGATWQDPQLVENLSLTSGSGCQISVINCSQK
IDGKDVVLLSAPAGDSRRNGYIYVGLVEQNGDAAGYVVNWTYKKEITNADTYFAYSCLTE
LPDGNIGLLYEQANTPQNVDTVVFASFSLSELCEEEIQ

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	51	507	7.2e-92	0.9473684210526315

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.49e-88	53	508	12	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4409	NanH	3.91e-62	53	495	273	704	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13088	BNR_2	2.05e-19	261	398	78	203	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU76745.2	8.28e-103	44	492	233	682
QJU17595.1	8.28e-103	44	492	233	682
ASU31741.1	8.28e-103	44	492	233	682
QQQ95451.1	8.28e-103	44	492	233	682
ETD19277.1	2.61e-100	44	492	245	694

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4X6K_A	8.51e-105	40	492	4	457	Crystalstructure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with Siastatin B [[Ruminococcus] gnavus CC55_001C]
4X47_A	9.30e-105	40	492	7	460	Crystalstructure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with Neu5Ac2en [[Ruminococcus] gnavus ATCC 29149],4X49_A Crystal structure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with oseltamivir carboxylate [[Ruminococcus] gnavus ATCC 29149],4X4A_A Crystal structure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with 2,7-Anhydro-Neu5Ac [[Ruminococcus] gnavus ATCC 29149]
1SLI_A	1.66e-102	33	512	190	675	LeechIntramolecular Trans-Sialidase Complexed With Dana [Macrobdella decora],1SLL_A Sialidase L From Leech Macrobdella Decora [Macrobdella decora],2SLI_A Leech Intramolecular Trans-Sialidase Complexed With 2,7- Anhydro-Neu5ac, The Reaction Product [Macrobdella decora],3SLI_A Leech Intramolecular Trans-Sialidase Complexed With 2,7- Anhydro-Neu5ac Prepared By Soaking With 3'-Sialyllactose [Macrobdella decora],4SLI_A Leech Intramolecular Trans-Sialidase Complexed With 2- Propenyl-Neu5ac, An Inactive Substrate Analogue [Macrobdella decora]
5TSP_A	6.65e-97	50	491	19	430	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2BF6_A	3.66e-96	50	491	18	429	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27701	6.54e-101	33	512	270	755	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
P29767	1.80e-93	50	497	390	815	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
Q54727	3.08e-76	44	492	233	670	Sialidase B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=nanB PE=1 SV=2
P62576	1.65e-59	32	517	336	794	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
P62575	1.65e-59	32	517	336	794	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.618849	0.378935	0.001279	0.000385	0.000232	0.000320

TMHMM  Annotations     

start	end
7	26