CAZyme Information: MGYG000000127_00123

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_00123
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626	MGYG000000127_1|CGC3	71175.11	4.9975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 139825; End: 141705 Strand: -

Full Sequence      

MRIGYAIQIDGQSVFHPFESDNGVLQNSYVHRHDASGMDICLRLDQNLTGCGKVSLAIKN
TDTKAHHIGSVYYITDIPEGCHLDYYTSDWGKEFEPCRVDATDFESIEVVSGRSSKGYSP
WIGCQSPDAYRSVALAWSGNWTIARRGDGQLYMGLDETYFQTELKAGESFDLCDIYFSEA
DTQEHSAAGLRQYFFNTDSLIKKEGWETLPVTYNTWWCYEDKLLNEDICIENAQIAAAAG
ATNFMLDAGWFGGNRKDISWFEKRGDWEDINTLDFPGGMASLGSRIMGTGLSFGIWCEIE
AIGEFAKLAHTHPEFLARRDGKRLGYICMADKNVRQWAMSHICRLVEQYHARWIKFDFNL
DPELGCNEENHGHGAMDGLYGHYMGYYQLLKDIHEKYPDVVLENCSSGGLRIDLGILRRT
HFTFLSDPDYVEHHFQCFWGATSFVPPACCYHFTQSDCLGDHNGIQTPIYEGMPMTTFDY
IIRSGMLCQIGLSYDLPKWPEALRQRLKMHLSFYRQISGKYILNGQMFRLCRQAIRGGLG
DRWQAYQYIAADASSLLFVFRLPGAGEETVIHPENIRPDKHYIIQNTDLDTSENIAGCTL
LQQGICITGMPEESSGIWMISEKDDR

Enzyme Prediction     

No EC number prediction in MGYG000000127_00123.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	58	604	8.2e-88	0.7863372093023255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	5.59e-56	209	516	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.71e-22	90	530	162	597	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	4.71e-22	191	517	33	340	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE98089.1	2.56e-170	83	617	92	629
AUS95874.1	5.88e-163	79	625	86	636
AYQ73890.1	1.08e-145	31	625	58	650
ABU59612.1	1.17e-141	78	620	131	682
AZN39989.1	3.19e-140	83	617	104	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	1.65e-28	112	613	222	709	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
2XN0_A	4.85e-25	64	517	168	632	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	4.85e-25	64	517	168	632	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
3MI6_A	1.17e-19	76	586	185	697	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
6PHU_A	2.69e-19	132	530	262	653	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	1.27e-27	112	613	222	709	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P16551	2.06e-27	4	447	76	525	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1
G1UB44	2.66e-24	64	517	168	632	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
Q5ARP5	7.80e-23	89	562	197	668	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
Q0CEF5	4.22e-22	73	562	177	667	Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_00123.