CAZyme Information: MGYG000000391_00287

Basic Information

• Species: UBA11475 sp003538975
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA11475; UBA11475 sp003538975
• CAZyme ID: MGYG000000391_00287
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase Mel36A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		83359.28	5.7693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000391	1644097	MAG	Sweden	Europe

• Gene Location: Start: 300136; End: 302313 Strand: -

Full Sequence      

MIKLTEKYIKIDTAKNTLLLEKYGDRVLQLYYGKKLHDSDNYGFFAVEERDKWFGSNDDH
TNIPTVFSSNGECANKEAYVILSKEDGAFISRFEFKGAEIVDGFTSPLPTARNKGETVRL
CFTDLVTGAVVYQYYTVFEDSACIAVHSEVVNNSEKTLFVKRLMSCQLDFVTEKASVTTY
DGTWDLERLRHDTDLTAGRFEIDSKLGISSAVHNPFFMVKVDNTVMGFNLVWSGNHKETV
EISPYERMRILTGLNDYGFNYKLNAGETFVSPEAVFVAADTEGEVSREMHKFSLKHIVNP
NFAYKPRPVLINNWEATYFDFTGDKIYEIAKKAKECGIEMMVLDDGWFGARNNDRAGLGD
WYDNVEKTGGLKNLSYKIHALGLKFGLWVEPEMIQVDSDLYRAHPEYAMQIPGLTPIERR
HQLCVDMCNPELRRYLTDTLIKLFKDLGVDYVKWDHNRAMSDVYSSHEDYQGNYFYDYYV
NQYKMLKDITEAVPDVLFESCASGGSRYDLGMQYFMPQNWCSDNTNAFARLFIQEGTLAG
YPVSSLGAHVPNHWERPGVSWESRFNVSAMGAFGYECDITSVDRKTISVIKKQVAYFKKH
RNVFQYGEYYRLGESLCKSDLGGWSFVSEDKKEAIAVIIDKKVNNFWFKRPRFTFAGLNP
DYLYKVEMRPQSNLPESKVFSFTAYGDALMNGKLDFDNLYWHETDGYDMGSVFASRMFYI
KKIGR

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	10	691	4e-196	0.9883720930232558

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	4.02e-141	268	607	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	8.26e-128	30	667	24	649	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	1.53e-114	306	599	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	1.11e-56	26	264	2	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	8.66e-10	624	720	4	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT48597.1	6.06e-153	29	721	34	739
CBL25056.1	1.34e-151	29	721	34	739
ADY12418.1	4.29e-150	30	641	31	665
AEV29196.1	1.36e-148	1	671	1	699
AFR99396.1	4.71e-147	29	723	33	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3MI6_A	2.37e-135	8	691	13	709	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
2XN0_A	1.08e-124	62	691	75	709	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	8.34e-124	62	691	75	709	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
2YFN_A	1.40e-121	27	667	31	685	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNQ_A	1.37e-120	7	667	10	693	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43467	2.41e-127	24	690	29	707	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
G1UB44	5.92e-124	62	691	75	709	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
Q9ALJ4	1.48e-119	7	635	10	662	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G4T4R7	1.45e-118	27	667	31	685	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P27756	3.31e-114	2	612	3	633	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000391_00287.