CAZyme Information: MGYG000002762_00107

Basic Information

• Species: CAG-485 sp900554845
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900554845
• CAZyme ID: MGYG000002762_00107
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000002762_3|CGC2	82560.65	6.2569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002762	3275168	MAG	Netherlands	Europe

• Gene Location: Start: 18294; End: 20489 Strand: -

Full Sequence      

MNHRTLSAALLLLAAAPALDAEIINIVTDNNSLVLDAVKGGPLRYVYYGTRLSDAEANSV
WDANIPACEAYPFYGSYPEHESAMAMTHADGNMTMDMAVESVSKTTVDGQPVTVVTMKDR
YYPLTVKLNYRTYPKDDIIEMWTETTNGEKKPVVLRQFASGSLPVRCEDVWIQNYHGGWA
NEARVNDEPLRPGMKVIKNRDGARNAHTSRGEIMLSLDGKAREQTGRVIGAAVEYGGNYK
LRIDTDESLHHRLFAGMDEENSWYNLKPGETFVTPPLALTFSSDGMGTVSRRFHRWGREN
RLANGDKARKILLNSWEGVYFDINEEGMDRMMKDIASMGGELFVMDDGWFGAKYPRKNDS
SSLGDWIVDTNKLPNGINGLLESAKKNGVKFGIWIEPEMTNTISEFYEKHPELVVKAKNR
DVVKGRGGTQLVLDMGNPKAQEVVFQVVDTLLTKYPDIDYIKWDANAPIMSHGSQYQTAD
NQSHLYIDYHKGLVKTLERIRAKYPDVTIQLCASGGGRVNWGLLPYFDEFWTSDNTDALQ
RIYMQWGTSSFFPAIAMGSHISATPNHTTFRSVPIKFRADVAMSGRLGMEIQPANMNEED
KALCKQAIEAYKGIRDIVQFGDLYRLLSPYDEKGAASLMYVTPEKDDAVFFWWKTNPNYG
EKIPRVRMAGLQPERLYTVTELNRIDNKPLPFEGKQFTGKFLMESGLEIPVSHDVDWNKK
MDYSSRVLRIK

Enzyme Prediction     

No EC number prediction in MGYG000002762_00107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	24	708	1.9e-203	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	1.19e-120	271	621	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	2.51e-108	308	612	1	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	8.24e-106	41	686	19	655	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam16875	Glyco_hydro_36N	2.08e-37	41	267	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	1.20e-18	636	730	2	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP71829.1	0.0	8	730	10	733
QCD38146.1	0.0	8	730	10	733
ADY36266.1	0.0	22	731	26	735
QCD39023.1	0.0	1	728	1	732
QCP72715.1	0.0	1	728	1	732

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	5.18e-118	32	694	20	707	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	3.03e-116	32	731	20	725	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	3.25e-115	32	694	20	707	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]
4FNT_A	4.56e-115	32	694	20	707	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]
4FNU_A	8.98e-115	32	731	20	725	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	1.66e-115	32	731	20	725	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
Q5AU92	4.27e-114	114	726	156	749	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1
Q9UUZ4	3.22e-112	98	726	135	746	Alpha-galactosidase C OS=Aspergillus niger OX=5061 GN=aglC PE=1 SV=1
Q0CEF5	2.94e-110	114	728	130	720	Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglG PE=3 SV=1
Q0CVH2	7.15e-110	114	715	152	737	Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000267	0.999086	0.000145	0.000180	0.000154	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002762_00107.