CAZyme Information: MGYG000003161_00072

Basic Information

• Species: Eubacterium_R sp900540305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900540305
• CAZyme ID: MGYG000003161_00072
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695	MGYG000003161_1|CGC1	79557.86	5.0571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003161	2037503	MAG	United States	North America

• Gene Location: Start: 78851; End: 80938 Strand: -

Full Sequence      

MGILQKDSIFILETKNLQYAISADETGVYHLHWGDKCRIEDFEIPHYHEENSNHPALDFA
KTEYIPFGSTMYRECALKCVFSDGCRDTVLKYQDYKINGNTLEIALCDKHYPLAVTLVYK
IFENSDIIERYTIIKNLGENCITLEKAVSAEINLPETKPYTIINSNGSWGAEFRMTKQSL
KGGEIRFESRKGTTGHHHMPALIAGTDPQEEYGKIYFAVLAFSGNFCVEAERDFTGRTRA
ILGINSFDFSHTLHSGEEFVTPSVYCGISDGLGDMSNMLNEFAVSNVLPKNFADKELPVL
YNSWEATGFDVNEKHQLELAKKAAEIGCELFVMDDGWFSSRNNDQSGLGDWDINTQKFPE
GLTPLIEGVNALGMDFGLWFEPEMVNPKSRLYEEHPEWAYHYDARTPNLLRNQIVLNMTK
PEVQEYVFGFMDSMLSENNIKYIKWDMNRPFSEIGAENLENQKELWVRHSEGVFAVLDRL
RKKHPSVQFEACASGGGRTDLGALSHYDMVWPSDNTDPVDRLDIQRGYSLIYPIKCMRAW
VTQTNDNTRPTSLQFRLAVSMQGSLSIGSNLGEYSEKELEICKKYISLYKEIRNTVQFGN
LYRIMNYEDDGIYLNGYVNKDKSQAVYFACTGANSFFADKFVTLRFRGLDENAVYRAKSE
YREYEKSGAYFMSKGLDIKYEKPLEAEIFVLKKIK

Enzyme Prediction     

No EC number prediction in MGYG000003161_00072.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	9	676	8.3e-217	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	2.82e-141	259	599	2	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	7.67e-138	10	676	4	665	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	8.18e-134	296	591	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	7.34e-61	28	254	3	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	1.70e-11	617	691	6	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED94212.1	1.08e-207	1	694	1	696
QGQ93834.1	2.67e-198	6	678	7	682
AWY97085.1	3.21e-188	1	693	1	696
AUS98583.1	2.59e-186	5	694	7	713
AMC09013.1	1.58e-185	1	693	1	685

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	5.91e-129	56	655	68	690	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	1.65e-128	56	655	68	690	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	1.80e-127	56	655	68	690	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]
4FNT_A	5.00e-127	56	655	68	690	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]
4FNU_A	1.39e-126	56	655	68	690	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	9.02e-128	56	655	68	690	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G4T4R7	7.52e-115	9	695	11	721	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P27756	1.03e-114	1	678	1	703	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
G1UB44	1.51e-113	6	604	11	644	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
Q92457	3.46e-111	100	693	147	744	Alpha-galactosidase 2 OS=Hypocrea jecorina OX=51453 GN=agl2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003161_00072.