CAZyme Information: MGYG000003437_00027

Basic Information

• Species: Eubacterium_R sp900767025
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900767025
• CAZyme ID: MGYG000003437_00027
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		79887.07	5.0315

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003437	2166830	MAG	Fiji	Oceania

• Gene Location: Start: 29506; End: 31587 Strand: -

Full Sequence      

MIISKNNIFVLETKNTHYVLGVDEYGYNHHLHWGQKCDIDDYSIKDISDESSNHSKLDYI
KQEYTPFGKTMYRNCSIKADFTDGCREINLKYDGFDINGNCLKLDFSDVTYPLGISLNYE
IHDECDIITRWVTLTNKGEEPIFFEKLFSAQLNLPSKKPYTFKNTNGAWGAEFIETNTVL
QGGSWVNESRRGTTGHNQSPYFIAYQNADEVSGDVYFASLAYSGSFKVSAERDLFGITRI
ILGMNDFDFRFMLKGGESFETPKVFCGHTQGLGEMSRQMHRFAVDYVLPKSHNDKILPVL
YNSWEATEFDVNVKNQSALAELAAEIGVELFVMDDGWFGARNNDRAGLGDWYVNKEKFPN
GLDELIDRVNELGMDFGIWVEPEMVNKDSDLFRAHPDWAYHYDTRYACEMRNQLVLNMTR
ADVQEYLFDCLNDLLTNHNIKYVKWDMNRPFSETGAENLECPQMLWYLHTKAVYDIVDKL
KALHPHVAIESCSSGGGRSDYGALLHYDQVWTSDNTDAIDRMVIQKGYSLLRPIKTMRAW
VTDINWYNKPCSLDFRFNIAMQGALGVGGDLTKYSKEDLEICKRNVALYKDIRDIVQFGS
LYRLMDIDEDEILVNQYVNGDKSRSVCFIASKGTRFYKKPVPLRFRGLDSNKRYAFDFDS
RHYEKGGAYLMNVGIEIEVKCNDYNKILIIEEI

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	8	676	1.7e-219	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	9.14e-140	258	599	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	4.02e-134	6	693	1	683	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	3.14e-129	297	591	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	8.07e-55	26	249	1	251	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	1.22e-12	616	684	5	71	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED94212.1	4.59e-206	5	693	8	696
QGQ93834.1	1.50e-202	3	689	5	693
AUS98583.1	2.79e-196	5	693	8	713
AWY97085.1	6.44e-193	6	689	8	692
AIY84523.1	1.49e-191	1	687	3	685

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNR_A	2.79e-147	9	684	12	717	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNQ_A	3.93e-147	9	684	12	717	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	1.22e-145	9	684	12	717	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]
4FNU_A	2.42e-145	9	684	12	717	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNT_A	3.42e-145	9	684	12	717	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	1.53e-146	9	684	12	717	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	1.28e-119	5	684	11	721	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
G4T4R7	4.16e-119	8	684	11	710	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P27756	2.15e-117	102	684	127	710	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
P43467	5.69e-113	6	684	10	720	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003437_00027.