CAZyme Information: MGYG000003826_00122

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1601
• CAZyme ID: MGYG000003826_00122
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702		81119.32	4.7264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003826	1835600	MAG	United States	North America

• Gene Location: Start: 20603; End: 22711 Strand: -

Full Sequence      

MERIKISENGINLVFEVTDEKQFRLLHFSSLEFDEKTLGKPEHMKGFQFLEFNVSGLDRP
YERHGNKYIVTAPGYRMKFKGIKDYRNDQGRVLEISLADEETGLNTVTKIQFYDGVSVAR
FITEVINKGDKAYGIDYISSFNLSGIEKEGITSQEDKMEIYIPHNSWYREMQWRKYSLHE
LGMDECMETLEQHSSKPVRVSNVGNWSTKEFLPMALIRNNETDSNLFFQIENNGSWHWEI
SDTEGHLYLSVSGPNEIYSHWYKSLKPGEKFVSVPVAVGVSKGSYETSFAELTKYRRMIR
RENDDNKSLAVIFNDYMNCLWAWPTEEAEYPLIDAAAEVGCEYFCIDAGWYADGYWWDSV
GEWKESRKRFPNGLKTLTDYIRSKGLVPGIWIELEVMGINCPIAKEVSDDWFFCRHGERV
YDRSRYQLDFRNPEVIKFADDTIERLVNDYGVGYLKIDYNIEPGIGTDKYADSFGDGLLG
HERAYLDWLDKTFKKYPDLIIENCSSGGMRIDYALLSRCSIQSVSDQADYKYNSVIAANS
PSALTPEQAAIWSYPLNEGDDEEVVFNMINAMLLRIHQSGHLANISRQRRELVKEAISVY
KSIRNDIKISVPFWSLGFASFQDDFLSLGLDCGDKAYVAVWRKDGDEDTVTLPLDFTPIS
ARCIYPSFNEWKYEIVSNALKVELIKPYSARLFEIIKQDNEE

Enzyme Prediction     

No EC number prediction in MGYG000003826_00122.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	75	607	1.7e-88	0.7311046511627907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.69e-90	311	601	4	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.73e-26	275	516	5	250	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	1.36e-20	325	529	307	508	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	5.36e-10	337	472	33	137	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16499	Melibiase_2	4.71e-06	338	391	45	96	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL52223.1	0.0	1	698	1	703
QHQ59595.1	0.0	1	695	1	700
CCO06137.1	0.0	1	695	1	701
ADU21534.1	0.0	1	698	1	701
BCK00066.1	0.0	1	694	1	699

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	1.71e-25	87	512	131	538	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	3.00e-25	87	512	131	538	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNQ_A	3.76e-20	89	604	129	629	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	3.48e-19	265	604	284	629	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	4.24e-18	265	604	284	629	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1UB44	9.38e-25	87	512	131	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	1.57e-19	89	604	131	631	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q9ALJ4	1.90e-18	265	604	284	629	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
Q5AU92	3.15e-17	228	516	271	563	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1
Q5ARP5	1.61e-16	228	529	248	550	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003826_00122.