CAZyme Information: MGYG000003936_00243

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; V9D3004
• CAZyme ID: MGYG000003936_00243
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000003936_33|CGC1	35698.84	6.7685

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003936	1259772	MAG	United Kingdom	Europe

• Gene Location: Start: 1189; End: 2145 Strand: -

Full Sequence      

MSIIYNDKEKIFKLDTSGASYVMGIEGELGHLVHIYYGKKIKGNSSPAHVPGINFVNKLW
FMDGNPMEYPAGGCGDFRQHCIEIETKEGYTALEPVYISHSISKGKPKLYGLPATFADDG
ECSTLEIVLSDKPTGIEITLLYSVFEELDVITRSVKVKNTAEDSVLLKKIMSACLDIGNE
NFDMITLHGAWGRERNIVRTKLTRGRHGIFSERGVSGHQENPFMAIVTPETTQNTGEVYA
MNFVYSGNHEATCELTNGNQVRMVMGINPYKFSWKLEKGDEFTAPEVVMVHSCKGLGDMT
RTFHDLYRKHLIRGKYLY

Enzyme Prediction     

No EC number prediction in MGYG000003936_00243.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	11	314	3.1e-87	0.436046511627907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16875	Glyco_hydro_36N	4.51e-115	30	277	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
COG3345	GalA	1.48e-47	9	317	1	288	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	7.27e-10	282	316	2	36	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN32115.1	5.11e-110	1	316	1	324
QNU68286.1	9.87e-107	1	316	1	324
SNX53916.1	8.27e-105	1	316	1	324
ADL67728.1	2.53e-103	1	316	1	324
BCJ98578.1	7.56e-102	1	316	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	1.15e-75	1	318	1	326	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNQ_A	2.63e-75	1	316	1	324	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNT_A	3.84e-74	1	316	1	324	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]
4FNR_A	3.84e-74	1	316	1	324	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	3.84e-74	1	316	1	324	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	1.37e-73	1	318	1	326	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q9ALJ4	2.10e-73	1	316	1	324	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
Q9UUZ4	4.90e-62	12	316	41	343	Alpha-galactosidase C OS=Aspergillus niger OX=5061 GN=aglC PE=1 SV=1
Q5AU92	5.10e-62	12	316	44	346	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1
G1UB44	1.50e-61	3	316	6	328	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003936_00243.