CAZyme Information: MGYG000002323_00191

Basic Information

• Species: Escherichia sp000208585
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia sp000208585
• CAZyme ID: MGYG000002323_00191
• CAZy Family: GH37
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	MGYG000002323_2|CGC3	63695.55	4.6635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002323	4514939	Isolate	not provided	not provided

• Gene Location: Start: 118855; End: 120504 Strand: -

Full Sequence      

MLNQKIQNPNPDELMVEVDLCYELDPYELKLDEMLEAEPEPEMIEGLPASDALTPADRYL
ELFEHVQSAKIFPDSKTFPDCAPKMDPLDILIRYRKVRRHRDFDLRKFVENHFWLPEVYS
SEYVSDPQNSLKEHIDQLWPVLTREPQDHIPWSSLLALPQSYIVPGGRFSETYYWDSYFT
MLGLAESGREDLLKCMADNFAWMIENYGHIPNGNRTYYLSRSQPPVFALMVELFEEDGVR
GARRYLDHLKMEYAFWMDGAESLIPNQAYRHVVRMPDGSLLNRYWDDRDTPRDESWLEDV
ETAKHSGRPPNEVYRDLRAGAASGWDYSSRWLRDAGRLASIRTTQFIPIDLNAFLFKLES
AIANISALKGDKETETLFRQKANARRDAVNHYLWDDENGLYRDYDWRREQQALFSAAAIV
PLYVGMASHEQADRLANAVRSRLLTPGGILASEYETGEQWDKPNGWAPLQWMAIQGFKMY
GDDYLGDEIAHSWLKTVNQFYLEQHKLIEKYHIADGVPREGGGGEYPLQDGFGWTNGVVR
RLIGLYGEP

Enzyme Prediction     

EC	3.2.1.28

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	71	545	1.1e-182	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13270	treF	0.0	1	549	1	549	alpha,alpha-trehalase TreF.
PRK13272	treA	0.0	35	549	25	539	alpha,alpha-trehalase TreA.
COG1626	TreA	0.0	1	549	1	555	Neutral trehalase [Carbohydrate transport and metabolism].
PRK13271	treA	0.0	62	545	51	535	alpha,alpha-trehalase TreA.
pfam01204	Trehalase	0.0	70	547	1	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD75980.1	0.0	1	549	1	549
APW92657.1	0.0	1	549	1	549
AZQ82132.1	0.0	1	549	1	549
QIL97433.1	0.0	1	549	1	549
QCL40408.1	0.0	1	549	1	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z66_A	4.85e-185	48	543	40	536	Structureof periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	9.93e-183	62	545	17	501	Family37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	5.57e-177	62	545	17	501	Family37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	1.14e-71	105	549	79	557	ChainA, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.66e-70	105	549	79	557	ChainA, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7UL72	0.0	1	549	1	549	Cytoplasmic trehalase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=treF PE=3 SV=1
P62602	0.0	1	549	1	549	Cytoplasmic trehalase OS=Escherichia coli O157:H7 OX=83334 GN=treF PE=3 SV=1
P62601	0.0	1	549	1	549	Cytoplasmic trehalase OS=Escherichia coli (strain K12) OX=83333 GN=treF PE=1 SV=1
C4ZW66	0.0	1	549	1	549	Cytoplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=treF PE=3 SV=1
Q0TBT4	0.0	1	549	1	549	Cytoplasmic trehalase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=treF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002323_00191.