CAZyme Information: MGYG000002497_00183

Basic Information

• Species: Klebsiella aerogenes
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella aerogenes
• CAZyme ID: MGYG000002497_00183
• CAZy Family: GH37
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577	MGYG000002497_2|CGC5	64600.75	6.3323

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002497	5138968	Isolate	United States	North America

• Gene Location: Start: 171736; End: 173469 Strand: -

Full Sequence      

MTRSVLRRPETLTYLIRLALGGAILSLATFAAQADDNTSPVPQSPDELLGPLFNDVQSAK
LFPDQKTFADAVPNSDPLMILADYRMQKSQASFDLRHFVEINFTLPRDNDQYVPPKGQTL
RQHIDGLWPVLTRSTVEVEKWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWD
KVEDMVANFAAEIDRWGHIPNGNRSYYLSRSQPPFFSFMVELLASHDGDRALKTWLPQME
KEYRYWMEGADALTPGKANKRVVRMEDGALLNRYWDDNDTPRPESWLDDVTTAKNNPNRP
ATEIYRDLRSAAASGWDFSSRWMDNPQQLGTIRTTSILPVDLNALMFHMEKTIARASKAA
GDSAKAGQYDALANARQKALEKYLWNDKEGWYADYDLKSHKVRNQLTAAALFPLYVKAAS
RERAAKVAAAAESRLLKPGGLTTTTVNSGQQWDAPNGWAPLQWVAVEGLQNYGQKKVAME
VTWRFLSNVQHTYDSKQKLVEKYDVSSTGTGGGGGEYPLQDGFGWTNGVTLKMLDLVCPQ
EKPCDALPATRPTQTESATGQQPAANDAVAAAEKKAQ

Enzyme Prediction     

EC	3.2.1.28

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	61	536	3.7e-189	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13270	treF	0.0	52	536	62	545	alpha,alpha-trehalase TreF.
PRK13272	treA	0.0	8	540	4	539	alpha,alpha-trehalase TreA.
COG1626	TreA	0.0	38	543	47	558	Neutral trehalase [Carbohydrate transport and metabolism].
PRK13271	treA	0.0	1	563	1	562	alpha,alpha-trehalase TreA.
pfam01204	Trehalase	0.0	60	536	1	507	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKK79885.1	0.0	1	577	1	577
QRZ88782.1	0.0	1	577	1	577
QRZ85718.1	0.0	1	577	1	577
QFI16813.1	0.0	1	577	1	577
AWD04164.1	0.0	1	577	1	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JG0_A	0.0	36	568	1	531	Family37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	0.0	32	570	34	561	Structureof periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	3.94e-317	36	568	1	531	Family37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	3.14e-79	122	535	123	552	ChainA, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	4.63e-78	122	535	123	552	ChainA, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0Q337	0.0	6	565	6	567	Periplasmic trehalase OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=treA PE=3 SV=1
P59765	0.0	6	565	6	567	Putative periplasmic trehalase OS=Salmonella typhi OX=90370 GN=treA PE=5 SV=2
P13482	0.0	25	568	21	561	Periplasmic trehalase OS=Escherichia coli (strain K12) OX=83333 GN=treA PE=1 SV=1
C4ZTN8	0.0	25	568	21	561	Periplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=treA PE=3 SV=1
Q0TIH3	0.0	25	559	21	553	Periplasmic trehalase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001650	0.997207	0.000442	0.000293	0.000200	0.000173

TMHMM  Annotations     

start	end
13	32