CAZyme Information: MGYG000003922_00501

Basic Information

• Species: Bacteroides sp014385165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp014385165
• CAZyme ID: MGYG000003922_00501
• CAZy Family: GH38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1207	MGYG000003922_3|CGC3	134765.51	6.5131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003922	4876803	MAG	China	Asia

• Gene Location: Start: 136040; End: 139663 Strand: -

Full Sequence      

MKKQIAAIASAVILCSGASAQSPAPQSTQPKAYMVADAHLDTQWNWDIQTTIKHYVWNTI
NQNLFLLKQYPDYIFNFEGGVKYAWMKEYYPAQYEEMKKYIKEGRWHISGASWDATDALV
PSTESAIRNIMLGQDYYRKEFGVESTDIFLPDCFGFGWTLPTIASHCGLIGFSSQKLDWR
HKAFYGDSKHPFTIGLWQGIDGSSIMLAHGYDYGKRWKDEDLSENKQLLDLTKRTPLNMV
YRYYGTGDIGGSPTLESVRSVEKGLEGKGPLKIISATSDQLYKDFQPYESHPELPRFNGE
LLMDVHGTGCYTSQAAMKLYNRQNELLGDAAERAAVAAEWLNQATYPGSTLTDSWRRFIF
HQFHDDLTGTSIPRAYEFSWNDELISLKQFSSVLTSSIGAIASQMDTRVKGTPVVLYNAL
GFPVTDIAEIAIDLPTAPKGVTVYDANGKKVAAQLTGYTDGKAHLLIEATVPATGYAVYD
VRTSSANNTVAATVAHTIENSVYKITLDKNGDITSLLDKKNNKELVKPGKTIRLALFTKN
QSHAWPAWEVLKETTDREPISITDNVKVTLVENGELRKALCIEKRHGESAFKQYIRLYEG
SRADRIDFFNEIDWQSTNALLKAEFPLNIENPEATYDLGIGSVKRGNNTDIAYEVYAQYW
ADLTDSSNSYGVSVMNDSKYGWDKPNDHTLRLTLLHTPETANGYAYQNRQDYGHHCFTYS
LVGHKGELDKPATVEKAEILNQRLKAFHTDKHKGSLGKEFSFVHSDNRNVIIKALKKAED
SNEYVVRVYETGGKKAQTASLAFVGEILSASEADGTEKTIGKAAFNGNKLEVNIKPYSVK
TYKVRLKASAQPASSLQYANLPLKFNRKCSSFNEFRGEADFESGYSYAAELLPETMTVSN
IPFQLGEKEIANGMTCKGDTILLPAGHKYNRLYLLAASTDGDYVGTFRCGRNKTDLVVPS
YTGFIGQWGHTGHTKGYLKDAEIAHVGTHRHAPDGDQVYEFTYMFKFGIDVPEGATSLIL
PDNDKIVLFAATLVQEGNRPATAACELFRTAIKGNAASAQSMQTIGAKENLLKDAKVIAY
SGYTNDREKPEFMLDGNMETKWCDVSSTPNYVDFDLGEAKNISGWKLVNAGQESHAYITN
GCFLQGKNSLNEEWKTLDSIDGNTRNVVSREIGETPKIRYIRLLITRPTQSTGGKDTRIY
EFEVYQD

Enzyme Prediction     

EC	3.2.1.113	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	31	280	1.7e-54	0.9070631970260223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10789	GH38N_AMII_ER_cytosolic	1.88e-85	31	284	1	248	N-terminal catalytic domain of endoplasmic reticulum(ER)/cytosolic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38). The subfamily is represented by Saccharomyces cerevisiae vacuolar alpha-mannosidase Ams1, rat ER/cytosolic alpha-mannosidase Man2C1, and similar proteins. Members in this family share high sequence similarity. None of them have any classical signal sequence or membrane spanning domains, which are typical of sorting or targeting signals. Ams1 functions as a second resident vacuolar hydrolase in S. cerevisiae. It aids in recycling macromolecular components of the cell through hydrolysis of terminal, non-reducing alpha-d-mannose residues. Ams1 utilizes both the cytoplasm to vacuole targeting (Cvt, nutrient-rich conditions) and autophagic (starvation conditions) pathways for biosynthetic delivery to the vacuole. Man2C1is involved in oligosaccharide catabolism in both the ER and cytosol. It can catalyze the cobalt-dependent cleavage of alpha 1,2-, alpha 1,3-, and alpha 1,6-linked mannose residues. Members in this family are retaining glycosyl hydrolases of family GH38 that employs a two-step mechanism involving the formation of a covalent glycosyl-enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst.
COG0383	AMS1	7.47e-83	33	846	201	943	Alpha-mannosidase [Carbohydrate transport and metabolism].
cd10813	GH38N_AMII_Man2C1	1.65e-42	33	284	3	248	N-terminal catalytic domain of mammalian cytosolic alpha-mannosidase Man2C1 and similar proteins; glycoside hydrolase family 38 (GH38). The subfamily corresponds to cytosolic alpha-mannosidase Man2C1 (also known as ER-mannosidase II or neutral/cytosolic mannosidase), mainly found in various vertebrates, and similar proteins. Man2C1 plays an essential role in the catabolism of cytosolic free oligomannosides derived from dolichol intermediates and the degradation of newly synthesized glycoproteins in ER or cytosol. It can catalyze the cleavage of alpha 1,2-, alpha 1,3-, and alpha 1,6-linked mannose residues. Man2C1 is a cobalt-dependent enzyme belonging to alpha-mannosidase class II. It has a neutral pH optimum and is strongly inhitibed by furanose analogs swainsonine (SW) and 1,4-dideoxy-1,4-imino-D-mannitol (DIM), moderately by deoxymannojirimycin (DMM), but not by kifunensine (KIF). DMM and KIF, both pyranose analogs, are normally known to inhibit class I alpha-mannosidase.
pfam01074	Glyco_hydro_38	7.37e-42	31	284	1	254	Glycosyl hydrolases family 38 N-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.
pfam07748	Glyco_hydro_38C	2.97e-40	498	698	1	198	Glycosyl hydrolases family 38 C-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73993.1	0.0	1	1206	1	1205
QCQ48876.1	0.0	1	1206	1	1205
QUU05389.1	0.0	1	1206	1	1205
CAH06062.1	0.0	1	1206	1	1205
QCT76910.1	0.0	1	1206	1	1205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LZ1_A	1.36e-73	33	846	284	1077	Structureof S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_B Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_C Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_D Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-]
7DD9_A	7.77e-73	33	846	284	1077	ChainA, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct],7DD9_C Chain C, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct],7DD9_E Chain E, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct],7DD9_G Chain G, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct]
5JM0_A	8.28e-52	33	844	305	1094	Structureof the S. cerevisiae alpha-mannosidase 1 [Saccharomyces cerevisiae S288C]
2WYH_A	8.87e-17	16	823	12	913	Structureof the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYH_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYI_A Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS],2WYI_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54K67	1.26e-81	28	843	253	1083	Alpha-mannosidase G OS=Dictyostelium discoideum OX=44689 GN=manG PE=1 SV=1
Q9UT61	4.55e-73	33	846	284	1077	Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ams1 PE=1 SV=1
Q91W89	2.59e-66	28	841	248	1029	Alpha-mannosidase 2C1 OS=Mus musculus OX=10090 GN=Man2c1 PE=1 SV=1
Q9NTJ4	8.60e-65	28	839	249	1028	Alpha-mannosidase 2C1 OS=Homo sapiens OX=9606 GN=MAN2C1 PE=1 SV=1
P21139	2.05e-64	28	850	248	1039	Alpha-mannosidase 2C1 OS=Rattus norvegicus OX=10116 GN=Man2c1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000806	0.788310	0.210004	0.000347	0.000267	0.000232

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003922_00501.