CAZyme Information: MGYG000004723_00089

Basic Information

• Species: Acutalibacter sp900548545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp900548545
• CAZyme ID: MGYG000004723_00089
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	MGYG000004723_1|CGC3	89388.61	5.626

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004723	2308372	MAG	China	Asia

• Gene Location: Start: 106638; End: 108983 Strand: -

Full Sequence      

MKGYQDKYTIDVWRESRDLGDSPRVTILYVVLGSCSLRIQDQGIPLNKGDAFVVNYHQPA
KAVISEGSLVAALSLEYFTLCQTAGVSQAWFSMSLQDPQGHWYRQLRQRVESLILASTTQ
AQPFQELGALGEYYFLVQLLFRHFSQTEPEKLDKDKDKAARLLALLRGGDLSLQEMAAKM
YLSPAAVSRLFHKVTGENFSQYKQRVRLERVKGQLVDGQKPVTVIAMEAGFTSSTVFNRA
FKEAFGVTPSQYRKEMRQQREGQPAVDMQQVLAILEQEKQQDDKSHPVERVEASTEDAVP
WKKWPNRVLNVGPAHLLQSANMQNQVDLLAERLDIEYIRIWSLFSQQMMFEPSKEFNFSF
LDAVLDFCVDRRLKLHLDLAQRRDFSLASESSEIYSRDTPEQQNWFQLVDAFLHHIRLRY
TERVVSQWVFEFSFYLNEPYDAENGLSDLEVWERGYALIKSVFPKARVAGPGLIASSRPE
EAESTILQFLGCGCPPDIFTSVCYPYDYEGSLEGERIYQKKMTKVDNRDFLWEQTGFIKR
VLAEHGFAGEYWVTDWGFSLANRNYVQDSCFRGTSILEDVLKCQERVDALGVFCASDILS
AYGDASNVLSGSAGLLSQTGIRKPAYYAYRFLHSLGRYKLCQTEHCVVTQEGREEIRVLC
FNGKALGPKYYLLEENAHQPDDLDALFVDLEPLELELTIQGLEGRRGPYYVRQRILNEKQ
GSPLRKWISLGCVSSLSRDDIEFLERTSVPDVTLDRIPGKDGKLRLRVLLEPNELRIIVI
N

Enzyme Prediction     

No EC number prediction in MGYG000004723_00089.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	314	731	3.5e-37	0.9443155452436195

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3664	XynB	6.73e-28	320	778	4	422	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	2.70e-27	135	258	1	124	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	2.91e-26	170	253	1	84	helix_turn_helix, arabinose operon control protein.
pfam01229	Glyco_hydro_39	1.78e-25	312	775	25	482	Glycosyl hydrolases family 39.
pfam12833	HTH_18	6.33e-22	176	254	1	80	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMV13792.1	2.40e-107	25	778	27	792
QQQ92191.1	1.50e-91	23	778	23	794
QJU15301.1	1.50e-91	23	778	23	794
ASU27451.1	1.63e-91	23	778	27	798
ANU74646.2	1.63e-91	23	778	27	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4M29_A	5.43e-24	313	778	35	494	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	9.66e-24	313	778	35	494	ChainA, Beta-xylosidase [Caulobacter vibrioides]
6UQJ_A	5.75e-23	309	780	33	503	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2BS9_A	1.61e-18	324	780	37	480	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	3.77e-18	324	780	37	480	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36906	1.48e-16	331	773	44	472	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
Q936F1	3.21e-15	5	778	2	737	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2
Q6GD21	9.66e-15	5	778	2	737	Uncharacterized HTH-type transcriptional regulator SAS0078 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=SAS0078 PE=4 SV=1
Q8NYT6	9.66e-15	5	778	2	737	Uncharacterized HTH-type transcriptional regulator MW0077 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=MW0077 PE=4 SV=1
Q7A882	6.65e-14	5	778	2	737	Uncharacterized HTH-type transcriptional regulator SA0097 OS=Staphylococcus aureus (strain N315) OX=158879 GN=SA0097 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004723_00089.