CAZyme Information: MGYG000001827_00356

Basic Information

• Species: UMGS929 sp900546875
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; UMGS929; UMGS929 sp900546875
• CAZyme ID: MGYG000001827_00356
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	MGYG000001827_3|CGC1	51902.29	5.7259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001827	1794009	MAG	Denmark	Europe

• Gene Location: Start: 5625; End: 7013 Strand: -

Full Sequence      

MKKIKLAYIGGGSKQWARVFMTDLALTSDLTGEIALYDIDIPAAERNKRIGERINGNEKT
VSVWKYKVCQTLGEALEGADFVVISILPGTFDEMETDVHLPERYGIYQSVGDTAGPGGVL
RAMRTVPLYEGFAKAVREHCPDAWVINFTNPMSICVKTLYDVFPGIKAFGCCHEVFHAQE
FLCCVYAEMTGSSRPERKEMRTDAVGINHFTWISRAHCRGENVMDMLPGFIERYYEKGYC
EMPGVKPGDYALSPFYYGNKVKMELFRRYGALGAAGDRHLAEFFESGRFLNGKDGAEKWL
FHLTSVEYRKAERERLIREGEETANGKREISLKHSDEEAVSIMKALLGEGDLVTNVNLPN
RGQVSWLNEGDITETDCLISCDGIRPIAGDRLPESVRKLIAGCSSNINACYKGIKERDIG
KIYASFINQPLCSGLSFEEGRELFDLMVKGTRKYLDPFYDID

Enzyme Prediction     

No EC number prediction in MGYG000001827_00356.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	5	182	6.9e-54	0.9720670391061452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.27e-120	4	448	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	3.49e-94	1	460	1	441	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	7.06e-60	1	458	1	430	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	2.66e-52	5	182	1	177	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	5.80e-47	4	455	1	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU22671.1	8.96e-205	1	459	1	460
QTQ16221.1	9.87e-184	1	455	4	456
QTQ11811.1	2.82e-183	1	455	4	456
QTQ14011.1	3.99e-183	1	455	4	456
AZT89895.1	1.87e-151	2	455	10	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	4.91e-123	1	445	3	433	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	5.87e-24	2	459	3	438	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	1.10e-23	2	459	6	441	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	1.77e-13	1	386	1	403	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
3U95_A	3.10e-13	4	384	1	391	Crystalstructure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_B Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_C Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_D Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_E Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_F Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	4.70e-148	4	456	11	459	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	2.35e-145	4	455	11	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	2.01e-131	4	461	11	466	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	7.08e-127	1	449	7	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P06720	1.14e-34	1	455	2	445	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001827_00356.