CAZyme Information: MGYG000000018_01243

Basic Information

• Species: Coprococcus eutactus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus eutactus
• CAZyme ID: MGYG000000018_01243
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		39945.99	10.3913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000018	3280214	Isolate	United Kingdom	Europe

• Gene Location: Start: 465476; End: 466546 Strand: -

Full Sequence      

MKRRRVWQRIVSLLLVFVMVFTVAEIQPDADAFAAAKTPLATHGRLAVKGADLVDAKGRK
FQLRGVSTHGINWDVGYPYVNKAAFQTLRDDWGANAVRLAMYTSEYNGYCSGGNQAQLRN
QIYKGVKYATELGMYVIIDWHILNDGNPMTQLAQAKKFFATMSNKYKNQKNVIYEICNEP
NGCSWTSIKSYATQVIKVIRKYDKKAIIVVGTPTWSQLGSDGTHNEVANSPIKGYKNIMY
SLHFYANEWSHNKYLPAKLDYARKKGIAVMVTEFGMSAAGGGGGINSSYTGKWLGKLNKY
NISYFCWSLSNKNESCSLLSSKTKKTSKWKTTELSVAGRYIRSKYRARKKALGSKA

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	57	305	6.3e-87	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.45e-65	54	313	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.08e-12	79	248	81	278	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG3867	GanB	0.007	48	141	40	125	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83458.1	5.41e-222	1	356	1	358
QNL99979.1	2.12e-115	8	348	6	341
AFA47670.1	6.98e-101	37	354	196	506
QWT53734.1	1.18e-97	25	342	200	509
QNM00780.1	5.24e-96	38	342	213	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	3.92e-87	38	346	5	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZW_A	1.11e-83	37	344	3	301	Endo-glucanasechimera C10 [uncultured bacterium]
3PZT_A	1.10e-81	34	342	25	321	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZB_A	1.20e-77	37	344	3	302	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1A3H_A	1.12e-68	43	346	6	298	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07983	1.29e-80	18	349	14	333	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	7.89e-79	34	342	30	326	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	2.66e-76	34	342	30	326	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
Q59395	1.45e-73	38	347	33	330	Endoglucanase 6 OS=Pectobacterium parmentieri OX=1905730 GN=celV1 PE=3 SV=2
Q59394	2.40e-73	38	347	33	330	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000443	0.998805	0.000229	0.000182	0.000158	0.000150

TMHMM  Annotations     

start	end
7	24