CAZyme Information: MGYG000001319_00425

Basic Information

• Species: Butyrivibrio_A crossotus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A crossotus
• CAZyme ID: MGYG000001319_00425
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	MGYG000001319_11|CGC3	58511.35	4.833

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001319	2482799	Isolate	not provided	not provided

• Gene Location: Start: 277994; End: 279592 Strand: -

Full Sequence      

MTEDKRKKIITGCIIAGMVVLIIVLTTVILKVKKTKVGTADKTDPAEYSSSDITSKETES
VTVPQEQPTEYSSSDITSKETESITVPQEQPTTPAGNDKITNTVNYSVILKKNNSWSDGT
NEFFQYECIVTNNTGYDITSWKFEGNIGNVASIESSWNGNFAYKDGMLVITPLDWNGNIK
AGQTVSTCGVIIKGSNLKESVEYGSSCNNNYNNNTSASTETQYELPELENGTPLANHGKL
SVNGVNLVDSKGQKFQLKGVSTHGIQWFPQYVNKDTFKDLRDNWGANVIRLAMYSAEGGY
CNGNTAEFDKIIDRGVQACSELGMYVIIDWHILSDSNPNTNKEQAKQFFAKMSKQYADCN
NVIYEICNEPNGGVSWSEIKKYADEVIPVIRQYSKDAIIICGTPTWSQDVDLVASDPLQD
GHNVMYAVHFYAATHKDDLRNKVINAIKAGTPVFVSEFSICDASGNGGIDYDSAGKWKEL
INNYNLSFAGWSLCNKGETSALIKSGVSRLSGFTTSDLSETGIWLRNFISGK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	251	488	2e-95	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.26e-67	248	497	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.11e-15	239	501	49	368	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
smart00637	CBD_II	4.81e-13	113	196	1	80	CBD_II domain.
pfam00553	CBM_2	6.78e-09	103	186	2	77	Cellulose binding domain. Two tryptophan residues are involved in cellulose binding. Cellulose binding domain found in bacteria.
smart01063	CBM49	1.36e-05	107	195	1	84	Carbohydrate binding domain CBM49. This domain is found at the C terminal of cellulases and in vitro binding studies have shown it to binds to crystalline cellulose.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT53734.1	3.78e-151	108	532	75	515
QNM00780.1	1.44e-145	108	532	75	515
CBK83877.1	5.45e-138	130	532	102	530
QNM02472.1	7.38e-118	224	528	78	383
ACR73731.1	1.38e-116	111	532	73	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	9.74e-108	232	529	5	300	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
3PZT_A	2.47e-103	232	531	29	326	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZW_A	1.97e-101	232	526	4	299	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	4.56e-100	232	526	4	300	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1H11_A	2.78e-92	229	529	1	300	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15704	6.26e-101	238	532	45	338	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P10475	2.84e-100	232	531	34	331	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	7.95e-100	232	531	34	331	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	2.71e-97	232	531	34	331	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P22541	6.60e-95	219	530	93	408	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000040	0.000001	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
9	30