CAZyme Information: MGYG000002321_00026

Basic Information

• Species: Ruminococcus_D bicirculans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D; Ruminococcus_D bicirculans
• CAZyme ID: MGYG000002321_00026
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	MGYG000002321_1|CGC1	59976.32	10.0217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002321	2968500	Isolate	not provided	not provided

• Gene Location: Start: 30731; End: 32365 Strand: -

Full Sequence      

MVKLISLKKAAAVLLTSVTLMSAAAALPAVDETPLLSQTAITVEAASVGKVTGLTSKTLS
NSEIKLSWKKVSGASGYSVCMRKNGKYPQIADVKSGSTLTYTVKNLPNATRENFKVRAYK
TVKGKKVYGAYSDNWNTATNPQPAKGLKVSSVSYDSVKLSWTKIGCTNYRVFQLKNGQWK
EIAKTTGTSYTVKNLSQKTTYKFKIRACKTDDKKANHYGKYSAEVSATTSKAPAVVTPVS
QHGQLSVKGANIVDKNGKVFKIKGMSTHGIMWEDFSDILTKDSLKVLRDDWKVNTIRIAM
YTEEWGGYCTENGKYQAQAKQKVKTGVENAKSLGMYAIIDWHVLSDQNPNNHKNDAIKFF
TEMAKTYKDYNNVIYEICNEPNGGVTWTGGIKSYCQSVVSTIRKYDSDAIIICGTGTWSQ
DIDQVLGNKLSDKNCVYALHFYANTHTDWLRNRLQNCYKKGLPVLVSEFGTCDASGNGGY
NSTESTKWLKLLDSLKVGYINWSACGKSETASAFNSGTNLKAIKSGTSQLTASGKFIRDW
YRNH

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	255	501	1.2e-89	0.9957805907172996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.20e-68	253	508	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.99e-14	251	511	46	369	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd00063	FN3	9.00e-11	141	229	1	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	6.93e-09	141	207	1	76	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
pfam00041	fn3	3.54e-05	143	207	2	75	Fibronectin type III domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO03766.1	0.0	1	544	1	544
CBL33590.1	4.78e-101	233	544	279	585
CBK95395.1	1.98e-99	226	544	255	571
QHZ49094.1	2.59e-98	234	543	30	330
QNM02472.1	3.44e-98	230	543	77	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	3.18e-103	237	542	5	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
3PZT_A	3.14e-98	230	539	22	322	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZW_A	2.22e-97	237	538	4	299	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	4.51e-94	237	538	4	300	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1A3H_A	2.52e-82	239	542	3	298	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	8.43e-96	227	539	24	327	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	6.58e-95	230	539	27	327	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	7.91e-93	227	539	24	327	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
Q59394	1.39e-91	237	542	33	329	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1
Q47096	7.95e-91	237	542	33	329	Endoglucanase 5 OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=celV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000530	0.998661	0.000182	0.000230	0.000186	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002321_00026.