CAZyme Information: MGYG000003640_00315

Basic Information

• Species: Butyrivibrio_A sp900771195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A sp900771195
• CAZyme ID: MGYG000003640_00315
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634		66235.93	4.4378

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003640	1798350	MAG	Fiji	Oceania

• Gene Location: Start: 8302; End: 10206 Strand: -

Full Sequence      

MVDNENKVSDEQIKEVKNASDRFKILSIILAVFLVVVLAVGSMFAFGVIGRKASDSTQEG
IMMADAESTSVIETDDVTEKATEAETEKATEKVTEKATEKATEKATEKETEEETPKETTE
AATNENAGGQAPATTVGTNGGANGSGNASGSSGGSSGTSGSSGSTSGSGSTSGSGSSSGS
AGTGTFTLEFNVAGSWDSNGKKCMQYNVTVKNTSQVTIKSWQAEVDMPAGTSIVQNWGCE
CEMSGTKLVLKPADYTSEIAAGGSKGDIGLIIECPTNPGNFTGNGTTTDTGSSGGGNSSG
GSSGSGGSGSSGTTGPTTPVTPYVPPALEAGTPVGNHGQLSVKGTDLVDKNGQKYQLKGV
STHGIGWFPDYVNEAGFKTLRDNWGANLVRIAMYTAEYNGYCSGGNQNDLEALVCKGVEA
CTDLGMYVIIDWHILQDNNPNTNIEAAKVFFDRMSKRYASNVNVLYEICNEPNGGTSWAD
IKKYADTIIPIIRKNSPNAVIIVGTPTWSQDVDQVALNPLADGRNVMYALHFYAATHKDD
LRNKLKTAIAAGTPIFVSEFSICDASGNGGIDYDSAAAWKSLINSYNLSYAGWSLSNKNE
TSALINPSCSKLSDWETGDLSATGQWLRDMISGR

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	350	591	5.1e-92	0.9915611814345991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.49e-68	348	599	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.36e-15	332	537	37	227	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
smart00637	CBD_II	5.18e-10	205	272	9	75	CBD_II domain.
pfam00553	CBM_2	2.83e-08	187	264	2	75	Cellulose binding domain. Two tryptophan residues are involved in cellulose binding. Cellulose binding domain found in bacteria.
pfam09478	CBM49	3.21e-04	191	264	6	72	Carbohydrate binding domain CBM49. This domain is found at the C terminal of cellulases and in vitro binding studies have shown it to binds to crystalline cellulose.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM00780.1	4.91e-154	193	633	80	514
QWT53734.1	3.93e-153	193	633	80	514
CBK83877.1	3.53e-152	184	634	76	530
AIF26053.1	1.64e-126	337	632	20	315
CBK95395.1	8.10e-126	181	631	119	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	1.34e-106	332	631	5	300	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
3PZT_A	1.57e-99	332	633	29	326	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZW_A	3.54e-93	332	628	4	299	Endo-glucanasechimera C10 [uncultured bacterium]
1A3H_A	1.70e-89	334	631	3	297	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	1.87e-89	334	631	6	300	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07983	5.72e-98	326	633	26	331	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	3.15e-97	326	633	26	331	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P22541	5.16e-95	337	632	113	408	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P23549	7.34e-95	326	633	26	331	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
Q07940	2.40e-93	356	628	20	291	Endoglucanase 4 OS=Ruminococcus albus OX=1264 GN=Eg IV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	48