CAZyme Information: MGYG000001873_00009

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia
• CAZyme ID: MGYG000001873_00009
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502	MGYG000001873_1|CGC1	57469.56	4.9344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001873	2665919	MAG	Denmark	Europe

• Gene Location: Start: 11634; End: 13142 Strand: +

Full Sequence      

MSDSMLKLYGTRQRVTGRRDPMIYGHFIEHFHRQIYGGVYDPGNPLSDEDGFRLDVIDAM
RKIKVPILRWPGGCFVSSYHWKDAVGENRSPMFDKAWRVEDPNTFGTDEYIRLCRKIGCE
PYICTNAGTGTAEEMSDWVEYCNLENEGQYAKWRIQNGFQQPHKVRYWSIGNENYGFWEI
GAKTAGEWGHLVCETAKMIKHVDPDTELTAAALTDLNWNVRLLESSGQFLDWISIHEYWD
AIQQTNDYADYGAVCAYTNNIDHSIREVHGLLTAMKLDKKIRIAFDEWNLRGWYHPNVHT
IEQGRTKEDYLYPRDKNDDNSRYTMADAVFTACFLNACNRHCDIVGMANFAPIVNTRGCI
FTYPEGIVLRTTYHVFDLYVNYLGDTVLDGWSTDMPRITVRDKQGNTQETDVCDFAVTCF
SDREGLAVALVNKDPTNEQPVQLMLEAAGEAVLYYIAGESTDAYNDIRHTEVEIQRESLG
SYTPGMTIRLGPHMVGVLQIGL

Enzyme Prediction     

No EC number prediction in MGYG000001873_00009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	13	499	3.6e-107	0.7126984126984127

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	2.81e-123	17	502	15	500	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
pfam06964	Alpha-L-AF_C	5.60e-30	286	472	1	168	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
smart00813	Alpha-L-AF_C	6.59e-26	286	465	1	158	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE94709.1	2.56e-276	6	500	1	496
QIB56385.1	7.33e-276	6	500	1	496
QMW80840.1	7.33e-276	6	500	1	496
QJU16949.1	1.07e-270	6	501	1	506
AEF80325.1	4.23e-230	5	499	1	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2C_A	6.96e-95	23	472	20	453	Structureof the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_B Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_C Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_D Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_E Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_F Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_G Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_H Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_I Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_J Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_K Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_L Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]
4ATW_A	9.27e-95	23	472	20	453	Thecrystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_B The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_C The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_D The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_E The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_F The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8]
3UG3_A	1.73e-94	23	472	40	473	Crystalstructure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG4_A Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG5_A Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima]
1PZ3_A	6.99e-77	20	384	20	383	Crystalstructure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],1PZ3_B Crystal structure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],6SXU_AAA Chain AAA, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXU_BBB Chain BBB, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXV_A GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus],6SXV_B GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus]
1PZ2_A	5.35e-76	20	384	20	383	ChainA, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1PZ2_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9XBQ3	3.83e-76	20	384	20	383	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Geobacillus stearothermophilus OX=1422 GN=abfA PE=1 SV=4
A3DIH0	1.01e-71	20	366	18	366	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=Cthe_2548 PE=1 SV=1
A1CQC3	1.49e-71	14	465	21	470	Probable alpha-L-arabinofuranosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=abfC PE=3 SV=2
P94531	2.59e-71	17	500	15	496	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=abfA PE=1 SV=2
Q9KBR4	7.14e-71	17	459	16	454	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=abfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001873_00009.