CAZyme Information: MGYG000002365_00060

Basic Information

• Species: Bifidobacterium globosum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium globosum
• CAZyme ID: MGYG000002365_00060
• CAZy Family: GH51
• CAZyme Description: Exo-alpha-(1->6)-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	MGYG000002365_1|CGC2	56706.22	4.4883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002365	2036949	Isolate	Kenya	Africa

• Gene Location: Start: 62639; End: 64180 Strand: -

Full Sequence      

MTQQTETHAKLVVDDEFKVGPVHDRVFGSFVEHLGRCVYTGIYEPGHPTADEEGFRQDVI
DLVKELGATTIRYPGGNFVSGYNWEDGVGPKQDRPRRLDLAWHSTETNQFGLHEMASWLR
KAGGNELMEAVNLGTRGLAEALDLLEYANVPEGTARSEERIRNGAEDPFDIRMWCLGNEM
DGPWQTGHKSAEDYGKLAASVAAGMRMIDPDLELVVCGSSSHTMDTFGKWEEIVLEHTFD
KVNFVSAHAYYFPQIMPDGSRDMASFLASGVDMDGFIKDVGAAIDATRSRLKSDHNVYIS
FDEWNVWYMGEEPSKNPEGIGNWPVAPRLLEDIYSVADAVVVGDLLITLLQNADRVHAAS
LAQLVNVIAPIMTEPNGPAWRQTTFYPFSLTAAWAKGGSVLEPKIESPQYHTDRYGDVAS
TNAVAVRGADGSVSVFVTNRSLDDECTFDIKLPGDFTPHEIEARTLHDDDILAANTLHDQ
HRVEPYTNDSASMHSGTVSVTLPPVSWTAIQIR

Enzyme Prediction     

EC	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	8	512	8.4e-133	0.726984126984127

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	0.0	6	513	1	499	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
pfam06964	Alpha-L-AF_C	6.30e-63	302	506	1	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
smart00813	Alpha-L-AF_C	3.09e-55	302	506	1	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIZ15573.1	0.0	1	513	1	513
ASW24792.1	0.0	1	513	1	513
AFI62295.1	0.0	1	513	1	513
AYN22936.1	0.0	1	513	1	513
QQQ89603.1	0.0	1	513	1	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PZ3_A	7.57e-175	9	512	6	499	Crystalstructure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],1PZ3_B Crystal structure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],6SXU_AAA Chain AAA, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXU_BBB Chain BBB, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXV_A GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus],6SXV_B GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus]
1PZ2_A	6.13e-174	9	512	6	499	ChainA, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1PZ2_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus]
2Y2W_A	3.91e-172	15	513	52	565	Elucidationof the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_B Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_C Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_D Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_E Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_F Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum]
5O7Z_A	1.09e-166	9	512	3	500	ChainA, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_B Chain B, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_C Chain C, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_D Chain D, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_E Chain E, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_F Chain F, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_A Chain A, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_B Chain B, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_C Chain C, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_D Chain D, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_E Chain E, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_F Chain F, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila]
2C7F_A	1.63e-166	9	512	14	511	ChainA, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_B Chain B, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_C Chain C, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_D Chain D, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_E Chain E, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_F Chain F, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C8N_A Chain A, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_B Chain B, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_C Chain C, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_D Chain D, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_E Chain E, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_F Chain F, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E7CY70	4.23e-301	9	513	16	522	Exo-alpha-(1->6)-L-arabinofuranosidase OS=Bifidobacterium longum OX=216816 GN=afuB PE=1 SV=1
P53627	2.55e-199	9	511	4	499	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Streptomyces lividans OX=1916 GN=abfA PE=1 SV=1
Q9XBQ3	4.15e-174	9	512	6	499	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Geobacillus stearothermophilus OX=1422 GN=abfA PE=1 SV=4
Q841V6	1.64e-171	15	513	52	565	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Bifidobacterium longum OX=216816 GN=abfB PE=1 SV=1
P94531	1.54e-168	9	513	4	497	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=abfA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002365_00060.