CAZyme Information: MGYG000002608_00153

Basic Information

• Species: CAG-485 sp900541835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900541835
• CAZyme ID: MGYG000002608_00153
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000002608_1|CGC2	39543.64	4.4522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002608	2400131	MAG	China	Asia

• Gene Location: Start: 190163; End: 191212 Strand: +

Full Sequence      

MKTISIKGLLLAALSAIFTIHPFSAQEPLWLGGDISGVSADEARGRSFLDADGHDADPFR
LMRDYGMNAIRLRVWVNPIDGFCSPGDVVQMALRAKDLGMPVMIDFHYSDWWADPGKQNI
PEEWRDMGVEEMAQALAEHTRNTLDLLKSNDIDVRWVQVGNETTHGFLWPIGRFEENPDN
YAMLTQAGIDAVKEVYPEAQTIIHLDNGFDQELYDRVFDSLAERGVKWDIIGMSLYPYWA
MEGKFRPDEDSTLNDCIENIKHLKEKYGTDIMITEIGVDAREPEAGYNFMVKTFDKVIDE
VPDACKGVFYWAPEINADADYHLGAFSHDRPTKIMDAFKYASRKAAGTR

Enzyme Prediction     

No EC number prediction in MGYG000002608_00153.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	32	317	3.9e-91	0.8918128654970761

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	1.47e-89	32	320	3	304	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	3.52e-81	8	314	17	343	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF26228.1	1.79e-128	25	340	22	334
BCS85804.1	9.74e-121	7	338	2	333
AGB28883.1	4.05e-114	26	342	22	336
SCM59778.1	1.56e-102	32	339	42	359
ADE81415.1	1.65e-97	7	338	2	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GPA_A	1.10e-87	26	339	4	314	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
6GP5_A	3.60e-87	26	339	40	350	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OSK_A	2.28e-46	35	311	51	352	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
4BF7_A	3.48e-40	32	313	23	315	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1R8L_A	4.80e-38	32	313	27	322	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	2.57e-51	26	313	3	310	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
A1D3T4	5.25e-47	17	313	12	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
Q0CTQ7	5.05e-45	14	329	2	328	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1
B0XPR3	5.94e-45	17	313	12	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
Q4WJ80	2.29e-44	17	313	12	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000493	0.998632	0.000268	0.000213	0.000198	0.000177

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002608_00153.